(data stored in ACNUC7421 zone)

EMBL: CP001720.PE531

CP001720.PE531       Location/Qualifiers
FT   CDS             596666..597268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0576"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: bsu:BSU02890
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61496"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W641"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ACV61496.1"
FT                   /translation="MAINLQKGQKIDLTKGNPGLAKIMVGLAWDPVESPKKGGLLGSLL
FT                   GGGSKANFDCDASVFMLDEKVKYKNLVYFGNLKSPCGSVQHMGDNLTGQGEGDDEQIFI
FT                   DLSKVPAEIHRLVFVVNIYDCEKRKQDFGMIKNAYIRLVNQADNQELIRFNLSENYAGK
FT                   TTLIAGEVYKHNGEWKFSAMGEATTDTGLKSLAQRYA"
     MAINLQKGQK IDLTKGNPGL AKIMVGLAWD PVESPKKGGL LGSLLGGGSK ANFDCDASVF        60
     MLDEKVKYKN LVYFGNLKSP CGSVQHMGDN LTGQGEGDDE QIFIDLSKVP AEIHRLVFVV       120
     NIYDCEKRKQ DFGMIKNAYI RLVNQADNQE LIRFNLSENY AGKTTLIAGE VYKHNGEWKF       180
     SAMGEATTDT GLKSLAQRYA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page