(data stored in ACNUC7421 zone)

EMBL: CP001720.PE532

CP001720.PE532       Location/Qualifiers
FT   CDS             597298..597876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0577"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: bsu:BSU02910
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61497"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C8W642"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ACV61497.1"
FT                   /translation="MISLAKGQKVDLTKTNPGLSKIIVGLGWDVNKYDGGHQFDLDSVA
FT                   FLLNSEGKATGEKDFIFYGNKQDAAGSVMHSGDNRTGDGEGDDETLAIDLSKIPSAIEK
FT                   IAVCINIHEAAERSQNFGQVSNAYVRVINEDNGEELLKFDLGEDYSIETGIVTCEIYRH
FT                   SGEWKFNAIGSGFQGGLAALCANYGLDAG"
     MISLAKGQKV DLTKTNPGLS KIIVGLGWDV NKYDGGHQFD LDSVAFLLNS EGKATGEKDF        60
     IFYGNKQDAA GSVMHSGDNR TGDGEGDDET LAIDLSKIPS AIEKIAVCIN IHEAAERSQN       120
     FGQVSNAYVR VINEDNGEEL LKFDLGEDYS IETGIVTCEI YRHSGEWKFN AIGSGFQGGL       180
     AALCANYGLD AG                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page