(data stored in ACNUC7421 zone)

EMBL: CP001720.PE534

CP001720.PE534       Location/Qualifiers
FT   CDS             598711..599889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_01791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61499"
FT                   /db_xref="GOA:C8W644"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C8W644"
FT                   /inference="similar to AA sequence:KEGG:ESA_01791"
FT                   /protein_id="ACV61499.1"
FT                   /translation="MSYFSCFSKEQKKKLFFIPPTERSLDNDKKTLSYSLGATLYMPGS
FT                   SIQAVNKLIENKIPGLVSTVLCLEDAVDDRYVAHVEKNLNSQLKTLLIMEKKGSFLPFI
FT                   FIRVRSLEQFVRLTEDYEAILPILSGFVFPKFDHSNGHLYFEQLEKINRKAGKTLYGMP
FT                   ILETPGVIHLEKRYETLIEIKSILDKYKELVLNLRIGVTDLSGLYGLRRSCELTIYDIA
FT                   VIRDFIGALVNIFGRPKEGYVISGPVWEYFSSGQRILKSQLRQGYNQFDREYRSIREKL
FT                   LCRYIDGLIREVMLDKANGLIGKTIIHPSHLLPVQALHAVTHEEYCDAKDILSNNNGGV
FT                   SKSVYNNKMNEAKPHTYWAEKVLTLAKIYGVLNDKHDYTSIIYEGDKLQSIG"
     MSYFSCFSKE QKKKLFFIPP TERSLDNDKK TLSYSLGATL YMPGSSIQAV NKLIENKIPG        60
     LVSTVLCLED AVDDRYVAHV EKNLNSQLKT LLIMEKKGSF LPFIFIRVRS LEQFVRLTED       120
     YEAILPILSG FVFPKFDHSN GHLYFEQLEK INRKAGKTLY GMPILETPGV IHLEKRYETL       180
     IEIKSILDKY KELVLNLRIG VTDLSGLYGL RRSCELTIYD IAVIRDFIGA LVNIFGRPKE       240
     GYVISGPVWE YFSSGQRILK SQLRQGYNQF DREYRSIREK LLCRYIDGLI REVMLDKANG       300
     LIGKTIIHPS HLLPVQALHA VTHEEYCDAK DILSNNNGGV SKSVYNNKMN EAKPHTYWAE       360
     KVLTLAKIYG VLNDKHDYTS IIYEGDKLQS IG                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page