(data stored in ACNUC7421 zone)

EMBL: CP001720.PE535

CP001720.PE535       Location/Qualifiers
FT   CDS             599882..601207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecv:APECO1_O1R66 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61500"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:C8W645"
FT                   /inference="similar to AA sequence:KEGG:APECO1_O1R66"
FT                   /protein_id="ACV61500.1"
FT                   /translation="MDNLSVNIKINENPYDIPVSSVFSMAARNNPKRSYLFVSKLIGKH
FT                   IPVRPIVPFTAGYLLASRLAEYMGLTVNRKKIKEAVSLLSCEQAGDFQPVSYELSGKSL
FT                   FIGFAETATALGHAVYDCFKGNACYLHTTREDLRGTVDTIFFTEAHCHAPEQRCLVCDA
FT                   SLFTNNDLLVLIDDEITTGNTCLNFIKTIQEKYPQKHYIILTILDWRSKEAKEKYALFE
FT                   QELGIKLEVISLYTGSFGCSLSGSAEKEQLSPVNIAVNGKQVILTGEKSELSRVISHNE
FT                   PIGRQINLPGHYSSSYLQYTGRFGINIMDSDGLRKEALRLGRKLSQLRRGEKTLCLGTG
FT                   EFMYIPFLIAAGMGPGIAVQSTTRSPVQAHLRQGYAVQYAVTFTDPFRPNIKNFVYNIK
FT                   PFYYDEVFVFWEREVKPEAVAVLVQSLNGLGIERIVFVSHCR"
     MDNLSVNIKI NENPYDIPVS SVFSMAARNN PKRSYLFVSK LIGKHIPVRP IVPFTAGYLL        60
     ASRLAEYMGL TVNRKKIKEA VSLLSCEQAG DFQPVSYELS GKSLFIGFAE TATALGHAVY       120
     DCFKGNACYL HTTREDLRGT VDTIFFTEAH CHAPEQRCLV CDASLFTNND LLVLIDDEIT       180
     TGNTCLNFIK TIQEKYPQKH YIILTILDWR SKEAKEKYAL FEQELGIKLE VISLYTGSFG       240
     CSLSGSAEKE QLSPVNIAVN GKQVILTGEK SELSRVISHN EPIGRQINLP GHYSSSYLQY       300
     TGRFGINIMD SDGLRKEALR LGRKLSQLRR GEKTLCLGTG EFMYIPFLIA AGMGPGIAVQ       360
     STTRSPVQAH LRQGYAVQYA VTFTDPFRPN IKNFVYNIKP FYYDEVFVFW EREVKPEAVA       420
     VLVQSLNGLG IERIVFVSHC R                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page