(data stored in ACNUC7421 zone)

EMBL: CP001720.PE537

CP001720.PE537       Location/Qualifiers
FT   CDS             602394..603230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0582"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61502"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W647"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61502.1"
FT                   /translation="MIFASDLDRTLIYSERFLPGYIGKVEAVEQGKYISFMTEKSVELI
FT                   TGLFTQLIFVPCTTRTIEQYRRIRFFNRQYIPKFAVVSNGGNIIVDGVVHEGYRNNIAQ
FT                   KLSDNCLAGSQLLKEFEELASGEWSGRLVSADGLFYYCIIDRAKAPLEQIDAFADWALD
FT                   QNWEVSLQGRKLYLVPRLVNKWSAVEKIKELTGEQVVFAAGDSLLDLSMIENANQAIYP
FT                   AHGELYERFGKSLLNSRGQSVAATAVAGLAAAEQILLEAARFKEYGWNDKKAINNN"
     MIFASDLDRT LIYSERFLPG YIGKVEAVEQ GKYISFMTEK SVELITGLFT QLIFVPCTTR        60
     TIEQYRRIRF FNRQYIPKFA VVSNGGNIIV DGVVHEGYRN NIAQKLSDNC LAGSQLLKEF       120
     EELASGEWSG RLVSADGLFY YCIIDRAKAP LEQIDAFADW ALDQNWEVSL QGRKLYLVPR       180
     LVNKWSAVEK IKELTGEQVV FAAGDSLLDL SMIENANQAI YPAHGELYER FGKSLLNSRG       240
     QSVAATAVAG LAAAEQILLE AARFKEYGWN DKKAINNN                               278
//

If you have problems or comments...

PBIL Back to PBIL home page