(data stored in ACNUC7421 zone)

EMBL: CP001720.PE538

CP001720.PE538       Location/Qualifiers
FT   CDS             complement(603289..603516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61503"
FT                   /db_xref="GOA:C8W648"
FT                   /db_xref="UniProtKB/TrEMBL:C8W648"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61503.1"
FT                   /translation="MIWLLSLVFIIIIALEVPALIRKKLWRELTAYSIIMLIGMIYSYG
FT                   QLLDIPLPNPTKGIEAVFKPVSQMLQKLLS"
     MIWLLSLVFI IIIALEVPAL IRKKLWRELT AYSIIMLIGM IYSYGQLLDI PLPNPTKGIE        60
     AVFKPVSQML QKLLS                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page