(data stored in ACNUC7421 zone)

EMBL: CP001720.PE539

CP001720.PE539       Location/Qualifiers
FT   CDS             complement(603553..604776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0584"
FT                   /product="germination protein, Ger(x)C family"
FT                   /note="TIGRFAM: germination protein, Ger(x)C family; PFAM:
FT                   spore germination B3 GerAC family protein; KEGG: bha:BH1935
FT                   spore germination protein KC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61504"
FT                   /db_xref="GOA:C8W649"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:C8W649"
FT                   /inference="protein motif:TFAM:TIGR02887"
FT                   /protein_id="ACV61504.1"
FT                   /translation="MLLLTVIFTQTGCWDRKEVEDLAIVLAIAIEPGSGNNIKITVQNV
FT                   NPASAGKGSVVGSGSGMQTGTKSYRNRSIEGKTMFDAIRELSRQSPQQLFFAHNQLIIF
FT                   SEDLAQKRGVSDIIDFLERNPQIRRNTWVLVGRGEMATLLDEPGRLQTTPSQRIFDIIN
FT                   QRDFSSKYAIKRLGDFLEMLESKDKQAYTAVVEYTPNLAVPREHEEHGMEHGMEQGQPP
FT                   EPHDNIELRGTAVFREDKMVGWLNPEESRGLLWVRGEVKGGIIDIPSPDEKNKPISLEI
FT                   LSSKTKLEPQINEGQLQININVKTETNIAETTSTMNIARPEKIKELEKLVGKAVQAEIQ
FT                   AALDKTMQEYTTDVLGFAEAIHRKFPSEWKSLGKNWSSTFPTVEVTITVDAKIRRIGLV
FT                   SDPLKPRL"
     MLLLTVIFTQ TGCWDRKEVE DLAIVLAIAI EPGSGNNIKI TVQNVNPASA GKGSVVGSGS        60
     GMQTGTKSYR NRSIEGKTMF DAIRELSRQS PQQLFFAHNQ LIIFSEDLAQ KRGVSDIIDF       120
     LERNPQIRRN TWVLVGRGEM ATLLDEPGRL QTTPSQRIFD IINQRDFSSK YAIKRLGDFL       180
     EMLESKDKQA YTAVVEYTPN LAVPREHEEH GMEHGMEQGQ PPEPHDNIEL RGTAVFREDK       240
     MVGWLNPEES RGLLWVRGEV KGGIIDIPSP DEKNKPISLE ILSSKTKLEP QINEGQLQIN       300
     INVKTETNIA ETTSTMNIAR PEKIKELEKL VGKAVQAEIQ AALDKTMQEY TTDVLGFAEA       360
     IHRKFPSEWK SLGKNWSSTF PTVEVTITVD AKIRRIGLVS DPLKPRL                     407
//

If you have problems or comments...

PBIL Back to PBIL home page