(data stored in ACNUC7421 zone)

EMBL: CP001720.PE54

CP001720.PE54        Location/Qualifiers
FT   CDS             61854..62534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61019"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61019.1"
FT                   /translation="MLIATDRVLAMRCPVCGKLEYHNLSRFWFSDYEAVQVICSCGAVK
FT                   LVVEPKRDSKFWHISVSCVVCEDMHLHRISRKNLWHGNKVICLFCHDTGLELGYWGTIL
FT                   EVEGVLSEKDDEIATLLNEITKDDYFINSEIMYEVINCLHDIADRGFLYCQCGNNDIEL
FT                   DIFPERLELHCKGCDSINIIYAENEDDLKFIRQIDKIELPRNGFKFLDSLDSVKNKKNR
FT                   RRRK"
     MLIATDRVLA MRCPVCGKLE YHNLSRFWFS DYEAVQVICS CGAVKLVVEP KRDSKFWHIS        60
     VSCVVCEDMH LHRISRKNLW HGNKVICLFC HDTGLELGYW GTILEVEGVL SEKDDEIATL       120
     LNEITKDDYF INSEIMYEVI NCLHDIADRG FLYCQCGNND IELDIFPERL ELHCKGCDSI       180
     NIIYAENEDD LKFIRQIDKI ELPRNGFKFL DSLDSVKNKK NRRRRK                      226
//

If you have problems or comments...

PBIL Back to PBIL home page