(data stored in ACNUC7421 zone)

EMBL: CP001720.PE540

CP001720.PE540       Location/Qualifiers
FT   CDS             complement(604800..606458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0585"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   bsu:BSU03700 germination response to the combination of
FT                   glucose, fructose, L-asparagine, and KCl"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61505"
FT                   /db_xref="GOA:C8W650"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:C8W650"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ACV61505.1"
FT                   /translation="MVFGLFRKFIRKPPQRKPASCNRSAKKQPETDRRIYNTGELKEKQ
FT                   VSSSLNINLEMLQSILGQNSDIIFRRFNLGMTEETELAVIYAEGITDKTNLNNNILNPL
FT                   MLESHRRGFNPSKENILYMIKNFAVTVSNVSEASNINELVTATLEGNVILFINNQPTAL
FT                   ILHNTGVKSRAISEPQTEILVRGPKEGFIENLTTNISLIRRRLKSPNLIFEDLHIGRIT
FT                   YTRVTITYIKGIASPDLVAEIKRRLGRIDIDGILESGYLEELIEDNTFSPFPQILHTER
FT                   PDRVAASLLEGRVSILTDGTPFALIAPAEFVSFMTSPEDYYERYWLGTAIRWLRYIAMT
FT                   MSLLLPSLYIAVTTFHQEMIPTRLLISIAASRQGVPFPALVEALAMEFTFEAIREAGIR
FT                   LPRAIGQAVSIVGALVIGQAAVQAGIVSPLMIIVVAVTGMASFVNPSYNMGISLRLLRF
FT                   PMMLLGGTLGLFGIMAGILCIFIHLAGLRSFGVPYLASLAPLHLGDLKDVLIRAPWWAM
FT                   DKRPDETGKLNSRRQSRGLKPSVSNRTDKREDDQN"
     MVFGLFRKFI RKPPQRKPAS CNRSAKKQPE TDRRIYNTGE LKEKQVSSSL NINLEMLQSI        60
     LGQNSDIIFR RFNLGMTEET ELAVIYAEGI TDKTNLNNNI LNPLMLESHR RGFNPSKENI       120
     LYMIKNFAVT VSNVSEASNI NELVTATLEG NVILFINNQP TALILHNTGV KSRAISEPQT       180
     EILVRGPKEG FIENLTTNIS LIRRRLKSPN LIFEDLHIGR ITYTRVTITY IKGIASPDLV       240
     AEIKRRLGRI DIDGILESGY LEELIEDNTF SPFPQILHTE RPDRVAASLL EGRVSILTDG       300
     TPFALIAPAE FVSFMTSPED YYERYWLGTA IRWLRYIAMT MSLLLPSLYI AVTTFHQEMI       360
     PTRLLISIAA SRQGVPFPAL VEALAMEFTF EAIREAGIRL PRAIGQAVSI VGALVIGQAA       420
     VQAGIVSPLM IIVVAVTGMA SFVNPSYNMG ISLRLLRFPM MLLGGTLGLF GIMAGILCIF       480
     IHLAGLRSFG VPYLASLAPL HLGDLKDVLI RAPWWAMDKR PDETGKLNSR RQSRGLKPSV       540
     SNRTDKREDD QN                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page