(data stored in ACNUC7421 zone)

EMBL: CP001720.PE542

CP001720.PE542       Location/Qualifiers
FT   CDS             complement(607140..607931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0587"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61507"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C8W652"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACV61507.1"
FT                   /translation="MYQESGVLIELPPGALKYRATIMLENTPYNKITPVNDLYVYKSVD
FT                   INTIKNGGSTITSLEKLARISFFFDYIDFKRASQLNTNLSMGHFRIAYWDDTIQNWKQL
FT                   PSQVFWNEDKNQGMVEAEIDRSKARYALLWSNRQGEQLSPVSTGGIRIMVNYIPVKAQV
FT                   APYIKNGRTMVPLRAIAESLGAQVYWISSEQRIELLQNMNKLQLWIGKSTALKDGQSLL
FT                   LDVEPEIAGGYTFVPLRFVSEAFGAKVSWDEITKTAKVVSN"
     MYQESGVLIE LPPGALKYRA TIMLENTPYN KITPVNDLYV YKSVDINTIK NGGSTITSLE        60
     KLARISFFFD YIDFKRASQL NTNLSMGHFR IAYWDDTIQN WKQLPSQVFW NEDKNQGMVE       120
     AEIDRSKARY ALLWSNRQGE QLSPVSTGGI RIMVNYIPVK AQVAPYIKNG RTMVPLRAIA       180
     ESLGAQVYWI SSEQRIELLQ NMNKLQLWIG KSTALKDGQS LLLDVEPEIA GGYTFVPLRF       240
     VSEAFGAKVS WDEITKTAKV VSN                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page