(data stored in ACNUC7421 zone)

EMBL: CP001720.PE543

CP001720.PE543       Location/Qualifiers
FT   CDS             609064..609945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0588"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: baa:BA_2352 aminotransferase class IV;
FT                   TIGRFAM: branched-chain amino acid aminotransferase; PFAM:
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61508"
FT                   /db_xref="GOA:C8W653"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C8W653"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACV61508.1"
FT                   /translation="MGLIIYLNGNYVPEEQAVVSVFDHGLLYGDGVFEGIRAYHNRVFK
FT                   LEEHIKRLYESAKTIMLDIPLSMEKMSEVVLETLRRNNQRDAYIRLVVTRGKGDLGLDP
FT                   RKCTKATVFCITASIQLYPEELYNNGLITVTVPTRRNAGEAVNPRVKSLNYLNNIFAKI
FT                   EANLAGVPEAVMLNNEGYVAEATGDNIFIIKDGVLITPPVYAGLLEGITRNCVIEIART
FT                   KGIPVVETLFTRHDIFIADECFLTGTAAECIPVVQVDGRSIGNGKPGPMTHSLMKAFHE
FT                   LTETDGPQIFPE"
     MGLIIYLNGN YVPEEQAVVS VFDHGLLYGD GVFEGIRAYH NRVFKLEEHI KRLYESAKTI        60
     MLDIPLSMEK MSEVVLETLR RNNQRDAYIR LVVTRGKGDL GLDPRKCTKA TVFCITASIQ       120
     LYPEELYNNG LITVTVPTRR NAGEAVNPRV KSLNYLNNIF AKIEANLAGV PEAVMLNNEG       180
     YVAEATGDNI FIIKDGVLIT PPVYAGLLEG ITRNCVIEIA RTKGIPVVET LFTRHDIFIA       240
     DECFLTGTAA ECIPVVQVDG RSIGNGKPGP MTHSLMKAFH ELTETDGPQI FPE              293
//

If you have problems or comments...

PBIL Back to PBIL home page