(data stored in ACNUC7421 zone)

EMBL: CP001720.PE544

CP001720.PE544       Location/Qualifiers
FT   CDS             610036..611700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0589"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: sat:SYN_01708 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61509"
FT                   /db_xref="GOA:C8W654"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C8W654"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACV61509.1"
FT                   /translation="MRSDAMKLGLEKAPHRSLFKALGYTDQELARPLIGVVNAQNEIVP
FT                   GHLHLDDIAEAVKAGIRMAGGTPIEFPAIAVCDGIAMNHTGMKYSLASRELIADSIEVM
FT                   SIAHPFDGLVLIPSCDKIVPGMLMAAARLNIPAIVVSGGPMLAGKIKGQHKSLTNVFEA
FT                   VGSVRAGKMSEEELADLEEAACPGCGSCSGMFTANSMNCLTEVLGMALPGNGTIPAVSA
FT                   ARRRLAKQTGMQIMYLVKENICPSDILTMDAFNNGLTVDMALGCSTNTILHLPAIASEA
FT                   GVIIDLELVNKTSERTPNLCKLSPAGPHFIEELDEAGGIPAVMAELSKHDLLNLNSRTV
FT                   SGVTVGENINGSRVLRRDIIRNIEDPYSPSGGITVMRGNLAPDGAVVKKSAVAPEMLVH
FT                   RGPARVFNSEEESMDAIMNQTIQKGDVVVIRYEGPRGGPGMREMLTPTATLAGLGLDKE
FT                   VALLTDGRFSGATRGAAIGHVSPEAALGGVIAVIQDGDMIDIDIPNCRLNVDLTEAEID
FT                   ERMKKLVIPEPKITRGYLARYAKMVTSASTGAVLAKD"
     MRSDAMKLGL EKAPHRSLFK ALGYTDQELA RPLIGVVNAQ NEIVPGHLHL DDIAEAVKAG        60
     IRMAGGTPIE FPAIAVCDGI AMNHTGMKYS LASRELIADS IEVMSIAHPF DGLVLIPSCD       120
     KIVPGMLMAA ARLNIPAIVV SGGPMLAGKI KGQHKSLTNV FEAVGSVRAG KMSEEELADL       180
     EEAACPGCGS CSGMFTANSM NCLTEVLGMA LPGNGTIPAV SAARRRLAKQ TGMQIMYLVK       240
     ENICPSDILT MDAFNNGLTV DMALGCSTNT ILHLPAIASE AGVIIDLELV NKTSERTPNL       300
     CKLSPAGPHF IEELDEAGGI PAVMAELSKH DLLNLNSRTV SGVTVGENIN GSRVLRRDII       360
     RNIEDPYSPS GGITVMRGNL APDGAVVKKS AVAPEMLVHR GPARVFNSEE ESMDAIMNQT       420
     IQKGDVVVIR YEGPRGGPGM REMLTPTATL AGLGLDKEVA LLTDGRFSGA TRGAAIGHVS       480
     PEAALGGVIA VIQDGDMIDI DIPNCRLNVD LTEAEIDERM KKLVIPEPKI TRGYLARYAK       540
     MVTSASTGAV LAKD                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page