(data stored in ACNUC7421 zone)

EMBL: CP001720.PE546

CP001720.PE546       Location/Qualifiers
FT   CDS             613436..613936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0591"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: sfu:Sfum_3022
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61511"
FT                   /db_xref="GOA:C8W656"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:C8W656"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ACV61511.1"
FT                   /translation="MLHTLAVLVENNPGVLARVSGLFSRRGFNIDSLAVGRTDDPTISR
FT                   MTIVVEGDDQVLEQVRKQLNKLVDVIKIDDISSERHVDRELIIIKVNADTQTRSEIMQI
FT                   VDIFRAHIVDIGQETLIVEASGDSGKVNGLEEALKPFGIKEVARTGKIAMLRGAKATSL
FT                   NED"
     MLHTLAVLVE NNPGVLARVS GLFSRRGFNI DSLAVGRTDD PTISRMTIVV EGDDQVLEQV        60
     RKQLNKLVDV IKIDDISSER HVDRELIIIK VNADTQTRSE IMQIVDIFRA HIVDIGQETL       120
     IVEASGDSGK VNGLEEALKP FGIKEVARTG KIAMLRGAKA TSLNED                      166
//

If you have problems or comments...

PBIL Back to PBIL home page