(data stored in ACNUC7421 zone)

EMBL: CP001720.PE548

CP001720.PE548       Location/Qualifiers
FT   CDS             614080..615075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0593"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: dvl:Dvul_1690 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61513"
FT                   /db_xref="GOA:C8W658"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8W658"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACV61513.1"
FT                   /translation="MVQVYYDQDADLSLLAGKKIAVMGYGSQGHAQAQNLKDSGVDVVV
FT                   GLRRDSKRWAQAEADGLAVATVAEAANQADIIQILLPDETQAKVYNEEIAPNLSEGNVL
FT                   MFSHGFNIHFGQIVPPANVDVIMVAPKSPGHMVRRMYVDGAGVPCLVAVHQDYSGKAKD
FT                   IGLAYAKGLGGTKAGVFETSFKEETETDLFGEQAVLCGGLCELIQAGFDTLVEAGYAPE
FT                   MAYFECLHEVKLIVDLINEGGLNFMRYSISNTAEYGDYMTGKRIITEETRKEMKQVLAE
FT                   IQNGVFARNWMLENQVNRPVFNAIKKAQSESQIEVVGAGLRKMMPWLKKK"
     MVQVYYDQDA DLSLLAGKKI AVMGYGSQGH AQAQNLKDSG VDVVVGLRRD SKRWAQAEAD        60
     GLAVATVAEA ANQADIIQIL LPDETQAKVY NEEIAPNLSE GNVLMFSHGF NIHFGQIVPP       120
     ANVDVIMVAP KSPGHMVRRM YVDGAGVPCL VAVHQDYSGK AKDIGLAYAK GLGGTKAGVF       180
     ETSFKEETET DLFGEQAVLC GGLCELIQAG FDTLVEAGYA PEMAYFECLH EVKLIVDLIN       240
     EGGLNFMRYS ISNTAEYGDY MTGKRIITEE TRKEMKQVLA EIQNGVFARN WMLENQVNRP       300
     VFNAIKKAQS ESQIEVVGAG LRKMMPWLKK K                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page