(data stored in ACNUC7421 zone)

EMBL: CP001720.PE549

CP001720.PE549       Location/Qualifiers
FT   CDS             615176..616849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0594"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP- binding; KEGG: sfu:Sfum_2981 acetolactate
FT                   synthase, large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61514"
FT                   /db_xref="GOA:C8W659"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C8W659"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACV61514.1"
FT                   /translation="MGITVAEALVLCLERENVEVIFGYPGGAILPVYDALYKSNKIKHV
FT                   LVRHEQGAAHAADGYARATGKVGVCMATSGPGATNLVTGIANAYMDSVPIVAFTGQVPT
FT                   GMVGTDAFQEVDITGITMPVVKHNYFVKDPKQVPKIVREAFYIARTGRPGPVLIDLPKD
FT                   VTSAIIDYEEVEEINLRGYKPNYRADDEQVEKAAEMIKKSQCPVIYAGGGVVSAGAHDE
FT                   LKVLAETIGAPVTHTLLGLGGFPGDHPLFAGMLGLHGAMYANKIVTECDLLITLGARFD
FT                   DRVTGKIAGFAPDASVIHVDIDPAEIGKNVRVHLPVAGDVKTVIQQIIPLLEQKNNRQW
FT                   LERFAELKKQYALRYEPAAGEGLKPQQVIEKLNEVAQGNAIICTDVGQHQMWAAHYYRH
FT                   IQPRSFISSGGLGTMGYGYPAAIGAEFGCPGKQVILISGDGSFQMNLQEMATVMEQGLS
FT                   VKVIVLNNGRLGMVRQLQEFYCDKRYMAVDFSYHPDFAGIARVYGMKGFDIKTSEELNA
FT                   ILPEVLSSQGPAIINCFVQEDENVYPMVMAGKCIDEAIEG"
     MGITVAEALV LCLERENVEV IFGYPGGAIL PVYDALYKSN KIKHVLVRHE QGAAHAADGY        60
     ARATGKVGVC MATSGPGATN LVTGIANAYM DSVPIVAFTG QVPTGMVGTD AFQEVDITGI       120
     TMPVVKHNYF VKDPKQVPKI VREAFYIART GRPGPVLIDL PKDVTSAIID YEEVEEINLR       180
     GYKPNYRADD EQVEKAAEMI KKSQCPVIYA GGGVVSAGAH DELKVLAETI GAPVTHTLLG       240
     LGGFPGDHPL FAGMLGLHGA MYANKIVTEC DLLITLGARF DDRVTGKIAG FAPDASVIHV       300
     DIDPAEIGKN VRVHLPVAGD VKTVIQQIIP LLEQKNNRQW LERFAELKKQ YALRYEPAAG       360
     EGLKPQQVIE KLNEVAQGNA IICTDVGQHQ MWAAHYYRHI QPRSFISSGG LGTMGYGYPA       420
     AIGAEFGCPG KQVILISGDG SFQMNLQEMA TVMEQGLSVK VIVLNNGRLG MVRQLQEFYC       480
     DKRYMAVDFS YHPDFAGIAR VYGMKGFDIK TSEELNAILP EVLSSQGPAI INCFVQEDEN       540
     VYPMVMAGKC IDEAIEG                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page