(data stored in ACNUC7421 zone)

EMBL: CP001720.PE55

CP001720.PE55        Location/Qualifiers
FT   CDS             62600..63454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0057"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.40"
FT                   /note="KEGG: bha:BH3786 fructose-1,6-bisphosphate aldolase;
FT                   TIGRFAM: fructose-1,6-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61020"
FT                   /db_xref="GOA:C8VVF1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF1"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ACV61020.1"
FT                   /translation="MGLVPIDVLLKKADAEGYAVGAFNCNNMEIVQAIAAAAEAEKSPV
FT                   IMQASQGAIKYAGLEYIAAMAKLAADSVSVPVALHIDHGTSFEQVMKCIRAGFSSVMID
FT                   GSKLPLEQNIALTKKVLDVAHAVGVSVEAELGKIGGTEDDITVDEKEAMFTDPLEAERF
FT                   VRETSVDALAVAIGTAHGVYKGEPKLDFDRLKKIKELVKIPIVLHGSSGVPDDAIREAV
FT                   SLGVGKINIDTNIREAFVYKVREVAAAKPDEIDPRQILGPAREAAIEIIREKIRLFGSS
FT                   GKA"
     MGLVPIDVLL KKADAEGYAV GAFNCNNMEI VQAIAAAAEA EKSPVIMQAS QGAIKYAGLE        60
     YIAAMAKLAA DSVSVPVALH IDHGTSFEQV MKCIRAGFSS VMIDGSKLPL EQNIALTKKV       120
     LDVAHAVGVS VEAELGKIGG TEDDITVDEK EAMFTDPLEA ERFVRETSVD ALAVAIGTAH       180
     GVYKGEPKLD FDRLKKIKEL VKIPIVLHGS SGVPDDAIRE AVSLGVGKIN IDTNIREAFV       240
     YKVREVAAAK PDEIDPRQIL GPAREAAIEI IREKIRLFGS SGKA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page