(data stored in ACNUC7421 zone)

EMBL: CP001720.PE552

CP001720.PE552       Location/Qualifiers
FT   CDS             619730..621301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0597"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; 3-
FT                   isopropylmalate dehydratase, small subunit; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; aconitate
FT                   hydratase domain protein; KEGG: dvm:DvMF_1794
FT                   3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61517"
FT                   /db_xref="GOA:C8W662"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C8W662"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ACV61517.1"
FT                   /translation="MGLKGKAWKFGADIDTDAIIPARYLNTSDPVELAKHCMEDADTSF
FT                   AQKVQPGDVIVADKNFGCGSSREHAPISIKYAGVSCVIAKSFARIFYRNAFNIGLPILE
FT                   STEAVEGIDEGNEVSVNAETGTITNVTKGETYQATVVPPFMQQIIAAGGLINYVAERMK
FT                   VKKMYKIAVLPGDGIGPEITEQALKALKAVAEHFGHEFQFTEALVGGAAYDAVGHPLPK
FT                   ETLDLCYSSDAILLGAVGGDKWADLPPELTPERGALLPLRKLLGLYANLRPAVVFPALA
FT                   NASTLKPEVVEGLDIMVVRELTGGLYFGEKKREDLPDGTVRVTDTLVYTTEEIVRIARL
FT                   AFELAAKRRKKVTLVDKANVLESSRYWREVVANMAAEYPDIEFNTMYVDNAAMQLVKMP
FT                   KQFDVIVTDNMFGDILSDQASQLTGSLGMLASASIGGKIGLYEPSHGSAPKYAGLKRAN
FT                   PIATVMSGAMLLRYSFDMEKEAKAIEDAVTEVLKKYRTRDIMEEGLQLVNTDEMGDRIA
FT                   EQILAG"
     MGLKGKAWKF GADIDTDAII PARYLNTSDP VELAKHCMED ADTSFAQKVQ PGDVIVADKN        60
     FGCGSSREHA PISIKYAGVS CVIAKSFARI FYRNAFNIGL PILESTEAVE GIDEGNEVSV       120
     NAETGTITNV TKGETYQATV VPPFMQQIIA AGGLINYVAE RMKVKKMYKI AVLPGDGIGP       180
     EITEQALKAL KAVAEHFGHE FQFTEALVGG AAYDAVGHPL PKETLDLCYS SDAILLGAVG       240
     GDKWADLPPE LTPERGALLP LRKLLGLYAN LRPAVVFPAL ANASTLKPEV VEGLDIMVVR       300
     ELTGGLYFGE KKREDLPDGT VRVTDTLVYT TEEIVRIARL AFELAAKRRK KVTLVDKANV       360
     LESSRYWREV VANMAAEYPD IEFNTMYVDN AAMQLVKMPK QFDVIVTDNM FGDILSDQAS       420
     QLTGSLGMLA SASIGGKIGL YEPSHGSAPK YAGLKRANPI ATVMSGAMLL RYSFDMEKEA       480
     KAIEDAVTEV LKKYRTRDIM EEGLQLVNTD EMGDRIAEQI LAG                         523
//

If you have problems or comments...

PBIL Back to PBIL home page