(data stored in ACNUC7421 zone)

EMBL: CP001720.PE555

CP001720.PE555       Location/Qualifiers
FT   CDS             625024..626307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0600"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: dat:HRM2_03800 KamA1; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM: Radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61520"
FT                   /db_xref="GOA:C8W665"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:C8W665"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACV61520.1"
FT                   /translation="MKQKLLFANITEESNWSDWRWQLRNRIMSSDELDQYANLSVYEKA
FT                   SIQKAIDVFPMAITPYYASLINKDDSTCPIRMQCIPNPKELIKGSGDMDDPLHEDGDSP
FT                   CPGLTHRYPDRVLLLVTNECSMYCRHCTRKRKVGDNEKVSKDSDIIKAIEYIKAHPDIR
FT                   DVLLSGGDPFVLSTNRLEQIIRRVREIPHVQVIRIGTRTPVVMPQRITDHLVKMLKKYH
FT                   PIWINTHFNHPREFTEESARALAKLADAGIPLGNQTVLLKGINDCAFIIKKLAHLLVSN
FT                   RVRPYYLYQCDLSRGIEHFRTPVSKGVEIMEALIGHTSGFAVPTFVVDAPGGGGKIPVL
FT                   PNYQLSSTSTKTVLRNYEGVICIYEEPANYNSSCSSTCNVCKGSSALHDPIGLQKLINP
FT                   NAKMVSLIPEGNRRKKRLKIYKDILHDN"
     MKQKLLFANI TEESNWSDWR WQLRNRIMSS DELDQYANLS VYEKASIQKA IDVFPMAITP        60
     YYASLINKDD STCPIRMQCI PNPKELIKGS GDMDDPLHED GDSPCPGLTH RYPDRVLLLV       120
     TNECSMYCRH CTRKRKVGDN EKVSKDSDII KAIEYIKAHP DIRDVLLSGG DPFVLSTNRL       180
     EQIIRRVREI PHVQVIRIGT RTPVVMPQRI TDHLVKMLKK YHPIWINTHF NHPREFTEES       240
     ARALAKLADA GIPLGNQTVL LKGINDCAFI IKKLAHLLVS NRVRPYYLYQ CDLSRGIEHF       300
     RTPVSKGVEI MEALIGHTSG FAVPTFVVDA PGGGGKIPVL PNYQLSSTST KTVLRNYEGV       360
     ICIYEEPANY NSSCSSTCNV CKGSSALHDP IGLQKLINPN AKMVSLIPEG NRRKKRLKIY       420
     KDILHDN                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page