(data stored in ACNUC7421 zone)

EMBL: CP001720.PE557

CP001720.PE557       Location/Qualifiers
FT   CDS             complement(627267..627782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61522"
FT                   /db_xref="UniProtKB/TrEMBL:C8W667"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61522.1"
FT                   /translation="MVKIKTKIFYLLAPFLLGLSLGASGLNAYTGHYIDELLFRLKNLE
FT                   EQLAGNQSEIEQLKLNLIDKTHPVLSAINVYATVIDDNLTKLEQEQVKIETIKDVKQRL
FT                   VTMLGQELSKINFLQLALILDGREITADKIIFTQKVNLLIVKENVLNIYITCQPQKKKS
FT                   NTLGYLAK"
     MVKIKTKIFY LLAPFLLGLS LGASGLNAYT GHYIDELLFR LKNLEEQLAG NQSEIEQLKL        60
     NLIDKTHPVL SAINVYATVI DDNLTKLEQE QVKIETIKDV KQRLVTMLGQ ELSKINFLQL       120
     ALILDGREIT ADKIIFTQKV NLLIVKENVL NIYITCQPQK KKSNTLGYLA K                171
//

If you have problems or comments...

PBIL Back to PBIL home page