(data stored in ACNUC7421 zone)

EMBL: CP001720.PE558

CP001720.PE558       Location/Qualifiers
FT   CDS             complement(627769..628095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61523"
FT                   /db_xref="GOA:C8W668"
FT                   /db_xref="InterPro:IPR025689"
FT                   /db_xref="UniProtKB/TrEMBL:C8W668"
FT                   /inference="similar to AA sequence:KEGG:BH3170"
FT                   /protein_id="ACV61523.1"
FT                   /translation="MHVFFPKLVLIFFTAFGIMIGATLMGSLAALLMKEPPVATMLSLA
FT                   KEIKIWAIVAAIGGSFSTFEILESGIFQGDLKAMVKQFFFILSSFSGTHLGYFVVVNLT
FT                   GGKN"
     MHVFFPKLVL IFFTAFGIMI GATLMGSLAA LLMKEPPVAT MLSLAKEIKI WAIVAAIGGS        60
     FSTFEILESG IFQGDLKAMV KQFFFILSSF SGTHLGYFVV VNLTGGKN                    108
//

If you have problems or comments...

PBIL Back to PBIL home page