(data stored in ACNUC7421 zone)

EMBL: CP001720.PE56

CP001720.PE56        Location/Qualifiers
FT   CDS             63460..64119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0058"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: geo:Geob_0911 transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61021"
FT                   /db_xref="GOA:C8VVF5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF5"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ACV61021.1"
FT                   /translation="MVLEIKLFLDTANVEEIRDAYSLGVISGVTTNPSLIALEGRDFVQ
FT                   VVREIASIVDGPISAEAVSLEAAPMIEEARQLSSIHPNIVVKIPMTAEGLKAVKELSSQ
FT                   GIKTNVTLIFSANQALLAALAGASYVSPFVGRLDDIGYNGMQLIEEIMAIFNQYGLIAE
FT                   VIAASVRHPMHVIDAAKSGADIATIPYKVLYQMIKHPLTDSGIERFLKDWEKVPVK"
     MVLEIKLFLD TANVEEIRDA YSLGVISGVT TNPSLIALEG RDFVQVVREI ASIVDGPISA        60
     EAVSLEAAPM IEEARQLSSI HPNIVVKIPM TAEGLKAVKE LSSQGIKTNV TLIFSANQAL       120
     LAALAGASYV SPFVGRLDDI GYNGMQLIEE IMAIFNQYGL IAEVIAASVR HPMHVIDAAK       180
     SGADIATIPY KVLYQMIKHP LTDSGIERFL KDWEKVPVK                              219
//

If you have problems or comments...

PBIL Back to PBIL home page