(data stored in ACNUC7421 zone)

EMBL: CP001720.PE560

CP001720.PE560       Location/Qualifiers
FT   CDS             629443..630798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0605"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: bha:BH0267 phosphoglucosamine mutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61525"
FT                   /db_xref="GOA:C8W670"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W670"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ACV61525.1"
FT                   /translation="MGVMFGTDGVRGVANRELTPELAFKLGRAGAYILCKDNCNDRRII
FT                   IGKDTRISGDMLEAALAAGICSVGVNVLKVGILPTPAIAYLTRSLGAAAGVVISASHNP
FT                   VEDNGIKFFGPTGYKLPDETEDSIETAVLGDFAGIPSPTGSALGRTYELKDALDRYIMF
FT                   LQDTMDVDLTGLKVVVDCANGAAYKVAPRVLKELGAEVIPIFNRPDGVNINAWCGSTYP
FT                   VALQESVVATGADIGLAHDGDADRLIAVDHEGNIVDGDRIMLTIAKYMKENDKLTRNTV
FT                   VVTVMSNLGLHLALQKAGIKVVQTKVGDRYVMEKMLKLGARFGGEQSGHIIFLKHNTTG
FT                   DGVLTALQLMRVMKKTGRSLKALGEQMERLPQLLENVRVADKAAIMNSPELSAAIEKYE
FT                   EQLAGQGRILVRPSGTEPLVRVMVEGRDKKELEQISAAMIKLIHELSQGGDR"
     MGVMFGTDGV RGVANRELTP ELAFKLGRAG AYILCKDNCN DRRIIIGKDT RISGDMLEAA        60
     LAAGICSVGV NVLKVGILPT PAIAYLTRSL GAAAGVVISA SHNPVEDNGI KFFGPTGYKL       120
     PDETEDSIET AVLGDFAGIP SPTGSALGRT YELKDALDRY IMFLQDTMDV DLTGLKVVVD       180
     CANGAAYKVA PRVLKELGAE VIPIFNRPDG VNINAWCGST YPVALQESVV ATGADIGLAH       240
     DGDADRLIAV DHEGNIVDGD RIMLTIAKYM KENDKLTRNT VVVTVMSNLG LHLALQKAGI       300
     KVVQTKVGDR YVMEKMLKLG ARFGGEQSGH IIFLKHNTTG DGVLTALQLM RVMKKTGRSL       360
     KALGEQMERL PQLLENVRVA DKAAIMNSPE LSAAIEKYEE QLAGQGRILV RPSGTEPLVR       420
     VMVEGRDKKE LEQISAAMIK LIHELSQGGD R                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page