(data stored in ACNUC7421 zone)

EMBL: CP001720.PE563

CP001720.PE563       Location/Qualifiers
FT   CDS             633626..635380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0608"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: protein of unknown function UPF0047;
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase HD sub domain; KEGG: gsu:GSU2631
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61528"
FT                   /db_xref="GOA:C8W673"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C8W673"
FT                   /inference="protein motif:PRIAM:2.7.7.25"
FT                   /protein_id="ACV61528.1"
FT                   /translation="MQIPNYVLKVINKLKENGKQAFLVGGCVRDLLMGSEPADYDIATS
FT                   AAAQEILSLFGKTVPIGERHGTISVLLDGFTVEVSTFKGYVREEGPGGLEKDLSLRDFT
FT                   INAMAIDGEGGFYDPFGGQKDLEQKIIRSPGNEPEQRFIEDPLRMMRAIRFCCSFGFSL
FT                   HPDTNKAIAKNHALIQRSAPERVREELNRILISDLPSLGIRLLAETGLLRHVMPEAISL
FT                   VNFDQRDKPHSKDVFEHTMAVLEATPPRLNVRLAALLHDIGKTLTFSADERVTGHFYGY
FT                   SLKGCRVIESILKRLRYDNKTIENVSVLVGEHMSCFPKLRDVSLKRLVKRVGEHNLDDL
FT                   FDLQRANILVSATPFDFSDLDAMRQGIERILNEKSPLRIKDLAVNGRDLIAIGFRSGPE
FT                   MGRMLELLLDAVLDDSVKNDRVALLKIAEEYLMDRERGNSECDKEAKMKHYRKELWFEV
FT                   KKRRELINITPLVRECLQESGIKEGLLLCNAMHITASVFINDDESGLHQDFENWLEGLA
FT                   PEKPYSQYRHNTYEDNADAHLKRTIMGREVTVAITAGKLDLGPWEQIFYGEFDGKRRKR
FT                   VLVKIIGE"
     MQIPNYVLKV INKLKENGKQ AFLVGGCVRD LLMGSEPADY DIATSAAAQE ILSLFGKTVP        60
     IGERHGTISV LLDGFTVEVS TFKGYVREEG PGGLEKDLSL RDFTINAMAI DGEGGFYDPF       120
     GGQKDLEQKI IRSPGNEPEQ RFIEDPLRMM RAIRFCCSFG FSLHPDTNKA IAKNHALIQR       180
     SAPERVREEL NRILISDLPS LGIRLLAETG LLRHVMPEAI SLVNFDQRDK PHSKDVFEHT       240
     MAVLEATPPR LNVRLAALLH DIGKTLTFSA DERVTGHFYG YSLKGCRVIE SILKRLRYDN       300
     KTIENVSVLV GEHMSCFPKL RDVSLKRLVK RVGEHNLDDL FDLQRANILV SATPFDFSDL       360
     DAMRQGIERI LNEKSPLRIK DLAVNGRDLI AIGFRSGPEM GRMLELLLDA VLDDSVKNDR       420
     VALLKIAEEY LMDRERGNSE CDKEAKMKHY RKELWFEVKK RRELINITPL VRECLQESGI       480
     KEGLLLCNAM HITASVFIND DESGLHQDFE NWLEGLAPEK PYSQYRHNTY EDNADAHLKR       540
     TIMGREVTVA ITAGKLDLGP WEQIFYGEFD GKRRKRVLVK IIGE                        584
//

If you have problems or comments...

PBIL Back to PBIL home page