(data stored in ACNUC7421 zone)

EMBL: CP001720.PE565

CP001720.PE565       Location/Qualifiers
FT   CDS             635987..637126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0610"
FT                   /product="protein of unknown function DUF362"
FT                   /note="PFAM: protein of unknown function DUF362; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   gsu:GSU0494 iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61530"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W1"
FT                   /inference="protein motif:PFAM:PF04015"
FT                   /protein_id="ACV61530.1"
FT                   /translation="MNNHHVYVAVAKCPAYERDYVNTSVKNLIDFLGGIENYVLPEQKV
FT                   AVKPNLIAKKSPEEAATTHPLVVEAVVRLVQEAGGNPFIVDSPGGPSNKGLLSAVYRAT
FT                   GMEAVAKRTGCRLNWDMGEIELNHPRGRVVKKLTLLKALAEADVIISLPKLKTHGMTKY
FT                   TGAVKLMYGAIPGLKKAQYHFNMQKLEEFSQLLIDINTLLPASLNIMDGIIGMEGDGPT
FT                   AGSPRELGFLLASQSPFALDHICAGLIGLDPAILVFLKLAAEQGLYPPASSIKICGDKL
FT                   PESIVAFKIPGHKQIDFNLPGPLKKIVGRLQPKPVFNLQACRGCGECQKCCPAQAITML
FT                   NNKPLLTLSECIRCYCCQELCPHKAVHIQQHWLGKKLMR"
     MNNHHVYVAV AKCPAYERDY VNTSVKNLID FLGGIENYVL PEQKVAVKPN LIAKKSPEEA        60
     ATTHPLVVEA VVRLVQEAGG NPFIVDSPGG PSNKGLLSAV YRATGMEAVA KRTGCRLNWD       120
     MGEIELNHPR GRVVKKLTLL KALAEADVII SLPKLKTHGM TKYTGAVKLM YGAIPGLKKA       180
     QYHFNMQKLE EFSQLLIDIN TLLPASLNIM DGIIGMEGDG PTAGSPRELG FLLASQSPFA       240
     LDHICAGLIG LDPAILVFLK LAAEQGLYPP ASSIKICGDK LPESIVAFKI PGHKQIDFNL       300
     PGPLKKIVGR LQPKPVFNLQ ACRGCGECQK CCPAQAITML NNKPLLTLSE CIRCYCCQEL       360
     CPHKAVHIQQ HWLGKKLMR                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page