(data stored in ACNUC7421 zone)

EMBL: CP001720.PE566

CP001720.PE566       Location/Qualifiers
FT   CDS             637435..639486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0611"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; CheW
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; CheW domain protein; Hpt domain
FT                   protein; KEGG: pca:Pcar_1197 chemotaxis protein histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61531"
FT                   /db_xref="GOA:C8W0W2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61531.1"
FT                   /translation="MSDNFSSDPMLEMFIFETNQFTEQLEQIILDSEKSCGFDTASINE
FT                   IFRIMHTIKGSAAMMLYNNISGLAHSMEDLFYVLREEKPRNVNYSGISDIVLEGVDFIK
FT                   NEIAKLENGKPSTGDALALVEVIEAFVTKIKSCNDIAETPVNTAAEEQQKFYISPQALP
FT                   ITTANNTYEAVITFDEGCEMENIRAFSVVHSLKEKNVVLEFEPPDIIDNENSAGIIRQE
FT                   GFRIVFRTNMTIEEARTLLINETLFLRELEINVVETPAEPVKKRKEIVLEDDLPEDLAV
FT                   AGSVESEDAQPGSKQSFISVNILKLDRLLDLVGELVISEAMVLRNPEITVLQIESFQKA
FT                   ARQLEKITSELQDTVMSIRMVPLSTTFHKMNRIVRDMSKKLGKNVQLAIIGEETEVDKN
FT                   IIEHISDPLMHLIRNAVDHGLETTEERLAAGKPETGTVTLEANNEGGDVWIIVRDDGRG
FT                   LNRKTIIEKARESSLLKKNENELSEREVYSLILMPGFSTKERVTEFSGRGVGMDVVVRN
FT                   IEKVGGQILIDSSPGTGSVISIKIPLTLAIINGMAVKVGKSSYVIPTTMIRESFRAREE
FT                   DVIRDPDNNEMILIRGDCYPIIRLHKYYKKKEAVTNMQEGIIVMVENEFRGACLFADEL
FT                   LGEQQVVVKSLPRYIKKVKGIAGCTLLGDGSISLILDVANIINQGEER"
     MSDNFSSDPM LEMFIFETNQ FTEQLEQIIL DSEKSCGFDT ASINEIFRIM HTIKGSAAMM        60
     LYNNISGLAH SMEDLFYVLR EEKPRNVNYS GISDIVLEGV DFIKNEIAKL ENGKPSTGDA       120
     LALVEVIEAF VTKIKSCNDI AETPVNTAAE EQQKFYISPQ ALPITTANNT YEAVITFDEG       180
     CEMENIRAFS VVHSLKEKNV VLEFEPPDII DNENSAGIIR QEGFRIVFRT NMTIEEARTL       240
     LINETLFLRE LEINVVETPA EPVKKRKEIV LEDDLPEDLA VAGSVESEDA QPGSKQSFIS       300
     VNILKLDRLL DLVGELVISE AMVLRNPEIT VLQIESFQKA ARQLEKITSE LQDTVMSIRM       360
     VPLSTTFHKM NRIVRDMSKK LGKNVQLAII GEETEVDKNI IEHISDPLMH LIRNAVDHGL       420
     ETTEERLAAG KPETGTVTLE ANNEGGDVWI IVRDDGRGLN RKTIIEKARE SSLLKKNENE       480
     LSEREVYSLI LMPGFSTKER VTEFSGRGVG MDVVVRNIEK VGGQILIDSS PGTGSVISIK       540
     IPLTLAIING MAVKVGKSSY VIPTTMIRES FRAREEDVIR DPDNNEMILI RGDCYPIIRL       600
     HKYYKKKEAV TNMQEGIIVM VENEFRGACL FADELLGEQQ VVVKSLPRYI KKVKGIAGCT       660
     LLGDGSISLI LDVANIINQG EER                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page