(data stored in ACNUC7421 zone)

EMBL: CP001720.PE571

CP001720.PE571       Location/Qualifiers
FT   CDS             644408..646708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0616"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: gsu:GSU2314 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; response
FT                   regulator receiver; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61536"
FT                   /db_xref="GOA:C8W0W7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W0W7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV61536.1"
FT                   /translation="MWDNRDLTIKGNDTVMECRRLSNILECIGDGLITAATDGKVQFMN
FT                   KVAEKFLCWDLAEAKGKNIDEVFRMINLETNEILYTHYDQIIATQSPRGLRKDTVLLSR
FT                   DGMLRYVSASISPVKDMNNFVEAIVIVFRDITRRRSIEDAINSKQAKLKAVFDAAPVGI
FT                   MIVNSCHIIIELNDALGKILGRRPDQILLKKVGEGLGCKHRLENKKSCENGEIKCPLRY
FT                   TIQKVIEEQTECKGIEILFEMKKGDNIRKVWFKLNAVPIEIEKEKHVLMVIDDINEHKR
FT                   LIKELKKAKEAAEAASRAKSEFLANMSHEIRTPLNGLIGMLDLTLLSDLTVDQKENLSI
FT                   ARTCVDSLMNVLNDILDFSKIEAGKLLIENVGFNLPELVEKTVKSYSAKASEKDIGIKY
FT                   SVCSDVPETLSGDPNRLRQVLNNLLGNAIKFTQIGSVGIEVELLEKTREYVTLKFIVTD
FT                   TGIGISASDREKLFQGFSQVDGSYTRKYGGTGLGLAISKQLIEKMDGQIWVESNNHGGS
FT                   KFIFTTRLKTGAFSPEKKSNTCVYVASRELDILLAEDDKVSQMVIFRMLEEFGHSITIV
FT                   NNGKEALEILAKHDYDLILMDIQMPVMDGLATTSIIRQNECVKGKRTPIIALTAYAVKG
FT                   DKEKFLSHDMDDYVSKPVTMVDLFNTIERLNKKITINRPGCSGSYVNKVNDRFFKDIAV
FT                   KTANIRKAVAESNDLLAEKMAHLIKNDSEILQADFLKSLAFKIELAVRKGKIEQASDLC
FT                   SKIEMELDRLKLL"
     MWDNRDLTIK GNDTVMECRR LSNILECIGD GLITAATDGK VQFMNKVAEK FLCWDLAEAK        60
     GKNIDEVFRM INLETNEILY THYDQIIATQ SPRGLRKDTV LLSRDGMLRY VSASISPVKD       120
     MNNFVEAIVI VFRDITRRRS IEDAINSKQA KLKAVFDAAP VGIMIVNSCH IIIELNDALG       180
     KILGRRPDQI LLKKVGEGLG CKHRLENKKS CENGEIKCPL RYTIQKVIEE QTECKGIEIL       240
     FEMKKGDNIR KVWFKLNAVP IEIEKEKHVL MVIDDINEHK RLIKELKKAK EAAEAASRAK       300
     SEFLANMSHE IRTPLNGLIG MLDLTLLSDL TVDQKENLSI ARTCVDSLMN VLNDILDFSK       360
     IEAGKLLIEN VGFNLPELVE KTVKSYSAKA SEKDIGIKYS VCSDVPETLS GDPNRLRQVL       420
     NNLLGNAIKF TQIGSVGIEV ELLEKTREYV TLKFIVTDTG IGISASDREK LFQGFSQVDG       480
     SYTRKYGGTG LGLAISKQLI EKMDGQIWVE SNNHGGSKFI FTTRLKTGAF SPEKKSNTCV       540
     YVASRELDIL LAEDDKVSQM VIFRMLEEFG HSITIVNNGK EALEILAKHD YDLILMDIQM       600
     PVMDGLATTS IIRQNECVKG KRTPIIALTA YAVKGDKEKF LSHDMDDYVS KPVTMVDLFN       660
     TIERLNKKIT INRPGCSGSY VNKVNDRFFK DIAVKTANIR KAVAESNDLL AEKMAHLIKN       720
     DSEILQADFL KSLAFKIELA VRKGKIEQAS DLCSKIEMEL DRLKLL                      766
//

If you have problems or comments...

PBIL Back to PBIL home page