(data stored in ACNUC7421 zone)

EMBL: CP001720.PE58

CP001720.PE58        Location/Qualifiers
FT   CDS             65587..66549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0060"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; Peptidoglycan-binding LysM;
FT                   SMART: Peptidoglycan-binding LysM; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61023"
FT                   /db_xref="GOA:C8VVF7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF7"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACV61023.1"
FT                   /translation="MRLFGIYYHEMGIYIIMFKREGVSMEISGRKIKYAVSMLLVTSIF
FT                   AMGYPALARYDELIIPAGINNVVDIKSKGIKNEIYVVKSGDSLWKLSAMYGLTVEELMS
FT                   INGLPRDKDLILEGQKLRISAEKPVLHTVKKGETLISIAADYNSALSKLIEKNKISDIN
FT                   HLYEGQVLVVLPNEARNEQSSSLQQVSRNMPLMAFNWPVRGDISSVFGMRDGRPHQGVD
FT                   IAANEGESIKAARSGRVVFAGPRGTYGLAVILDHGRDVQTLYAHCSKILVSDGEDVEVG
FT                   QCIAEIGNTGRSTGPHLHFEVINRGVHYDPLLYLTRGYI"
     MRLFGIYYHE MGIYIIMFKR EGVSMEISGR KIKYAVSMLL VTSIFAMGYP ALARYDELII        60
     PAGINNVVDI KSKGIKNEIY VVKSGDSLWK LSAMYGLTVE ELMSINGLPR DKDLILEGQK       120
     LRISAEKPVL HTVKKGETLI SIAADYNSAL SKLIEKNKIS DINHLYEGQV LVVLPNEARN       180
     EQSSSLQQVS RNMPLMAFNW PVRGDISSVF GMRDGRPHQG VDIAANEGES IKAARSGRVV       240
     FAGPRGTYGL AVILDHGRDV QTLYAHCSKI LVSDGEDVEV GQCIAEIGNT GRSTGPHLHF       300
     EVINRGVHYD PLLYLTRGYI                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page