(data stored in ACNUC7421 zone)

EMBL: CP001720.PE6

CP001720.PE6         Location/Qualifiers
FT   CDS             4580..6487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60971"
FT                   /db_xref="GOA:C8VVA2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACV60971.1"
FT                   /translation="MPERITERYGAEEIQVLEGLEAVRRRPGMYIGSTGAKGLHHLVYE
FT                   VVDNSIDEAMAGYCDHIEVFINEDNSITVTDNGRGIPVDIHSKTGNSAVELVMTTLHAG
FT                   GKFGGGGYKVSGGLHGVGVSVVNALSKWLEVEVRRQGKIFFQRYERGIPVSDLKIVGDS
FT                   SFTGTKITFSPDEEIFEDVIFSRETLEQRLQELAYLNSRVKIYLKDFINNLEFSYMYEG
FT                   GIKDFVAHINQDKILLPEAPLYFVREKDHVMVEVAMQYTDAYFENLFSYVNNIHTIDGG
FT                   THEAGFRSALTRVINDYAKKNNLIKNNEGNLSGEDIREGLTAVISIKVPEPQFEGQTKG
FT                   KLGNSEVRGIVDSVVAEGLSTFLEENPAVSKKIIEKSISAFRAREAARKARELTRRKNV
FT                   LESSTLPGKLSDCSNRDPSESELYLVEGDSAGGSAKQGRDRKFQAILPLKGKILNVEKA
FT                   RLDKILNNDEIRAMITALGTGIGEDFDITKARYHKLIIMTDADVDGSHIRTLLLTFFYR
FT                   YMRPLIEAGYIFIAQPPLYRLKKGKMEIYLYSDRDLENKLKEVGRNGISIQRYKGLGEM
FT                   DAQQLWDTTMDPENRTILMVELENAAEADKIFDTLMGDRVEPRRSFINKHAHDVRNLDI
FT                   "
     MPERITERYG AEEIQVLEGL EAVRRRPGMY IGSTGAKGLH HLVYEVVDNS IDEAMAGYCD        60
     HIEVFINEDN SITVTDNGRG IPVDIHSKTG NSAVELVMTT LHAGGKFGGG GYKVSGGLHG       120
     VGVSVVNALS KWLEVEVRRQ GKIFFQRYER GIPVSDLKIV GDSSFTGTKI TFSPDEEIFE       180
     DVIFSRETLE QRLQELAYLN SRVKIYLKDF INNLEFSYMY EGGIKDFVAH INQDKILLPE       240
     APLYFVREKD HVMVEVAMQY TDAYFENLFS YVNNIHTIDG GTHEAGFRSA LTRVINDYAK       300
     KNNLIKNNEG NLSGEDIREG LTAVISIKVP EPQFEGQTKG KLGNSEVRGI VDSVVAEGLS       360
     TFLEENPAVS KKIIEKSISA FRAREAARKA RELTRRKNVL ESSTLPGKLS DCSNRDPSES       420
     ELYLVEGDSA GGSAKQGRDR KFQAILPLKG KILNVEKARL DKILNNDEIR AMITALGTGI       480
     GEDFDITKAR YHKLIIMTDA DVDGSHIRTL LLTFFYRYMR PLIEAGYIFI AQPPLYRLKK       540
     GKMEIYLYSD RDLENKLKEV GRNGISIQRY KGLGEMDAQQ LWDTTMDPEN RTILMVELEN       600
     AAEADKIFDT LMGDRVEPRR SFINKHAHDV RNLDI                                  635
//

If you have problems or comments...

PBIL Back to PBIL home page