(data stored in ACNUC7421 zone)

EMBL: CP001720.PE62

CP001720.PE62        Location/Qualifiers
FT   CDS             69400..70467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0064"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   bsu:BSU37010 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61027"
FT                   /db_xref="GOA:C8VVG1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG1"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACV61027.1"
FT                   /translation="MFERLQKIEERYEELGDLMGDPEVMADHSRWQQYVKAHADMQDIV
FT                   NVYREYRQLDQEVSDARELLKDKLDEDFREMVELELEELSEKKEELVQKLKLLLLPKDP
FT                   NDDKNVILEVRAGTGGEEAALFAGDLFRMYTRYAEKQGWRTEVLDANYTDIGGFKEVVC
FT                   MIEGKGAYSRLKFESGVHRVQRVPSTESGGRIHTSAATVAVLPEAEEVEIDINPNDLRI
FT                   DVFCSTGPGGQSVNTTQSAVRITHLPSGLVVSCQDEKSQHKNKDKAMRVLRARLKDLAE
FT                   SEQRSELASTRKSMVGSGDRSERIRTYNFPQNRITDHRIGLTTHRMPAVLMGEMDEIIE
FT                   ALITTDQADRLRSTE"
     MFERLQKIEE RYEELGDLMG DPEVMADHSR WQQYVKAHAD MQDIVNVYRE YRQLDQEVSD        60
     ARELLKDKLD EDFREMVELE LEELSEKKEE LVQKLKLLLL PKDPNDDKNV ILEVRAGTGG       120
     EEAALFAGDL FRMYTRYAEK QGWRTEVLDA NYTDIGGFKE VVCMIEGKGA YSRLKFESGV       180
     HRVQRVPSTE SGGRIHTSAA TVAVLPEAEE VEIDINPNDL RIDVFCSTGP GGQSVNTTQS       240
     AVRITHLPSG LVVSCQDEKS QHKNKDKAMR VLRARLKDLA ESEQRSELAS TRKSMVGSGD       300
     RSERIRTYNF PQNRITDHRI GLTTHRMPAV LMGEMDEIIE ALITTDQADR LRSTE            355
//

If you have problems or comments...

PBIL Back to PBIL home page