(data stored in ACNUC7421 zone)

EMBL: CP001720.PE64

CP001720.PE64        Location/Qualifiers
FT   CDS             71904..72830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0066"
FT                   /product="response regulator receiver modulated CheW
FT                   protein"
FT                   /note="PFAM: CheW domain protein; response regulator
FT                   receiver; SMART: CheW domain protein; response regulator
FT                   receiver; KEGG: bha:BH2262 modulation of CheA activity in
FT                   response to attractants (chemotaxis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61029"
FT                   /db_xref="GOA:C8VVG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG3"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACV61029.1"
FT                   /translation="MEKGKGILLESGTNELEIVEFSIGNAQFGINVIKVREIVELMPVF
FT                   KIPNAHPCIEGIIKLRDSIMKVVDLARALNYDPSPRPESDKLIVAEFNQLKVAFRVHGV
FT                   SRIHRISWEQIEQPSDIYQVDCNTTIGIVKMGDRIILLLDYEKIVAEISPQSAVLSDSL
FT                   KVLSDRERSDKNIMVVDDSATLRSFLKQVLTEAGYTNLSYYNNGSVAWDYLVSLVQDKG
FT                   EQLFEEIQLVITDIEMPKMDGHHLTKRIKEHPLLRKLPVVIFSSLITEDLLHKGYAVGV
FT                   DAQISKPQYLDLIGTIDKLISSINNGQ"
     MEKGKGILLE SGTNELEIVE FSIGNAQFGI NVIKVREIVE LMPVFKIPNA HPCIEGIIKL        60
     RDSIMKVVDL ARALNYDPSP RPESDKLIVA EFNQLKVAFR VHGVSRIHRI SWEQIEQPSD       120
     IYQVDCNTTI GIVKMGDRII LLLDYEKIVA EISPQSAVLS DSLKVLSDRE RSDKNIMVVD       180
     DSATLRSFLK QVLTEAGYTN LSYYNNGSVA WDYLVSLVQD KGEQLFEEIQ LVITDIEMPK       240
     MDGHHLTKRI KEHPLLRKLP VVIFSSLITE DLLHKGYAVG VDAQISKPQY LDLIGTIDKL       300
     ISSINNGQ                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page