(data stored in ACNUC7421 zone)

EMBL: CP001720.PE65

CP001720.PE65        Location/Qualifiers
FT   CDS             73077..73337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61030"
FT                   /db_xref="GOA:C8VVG4"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61030.1"
FT                   /translation="MKKKNIIIVMGVILVFSMGVYMEKHFSFSRGLVEGTQDVLRKTHI
FT                   LSERLVKEIKQAISTVKITSAIILGILAKGNIKNRLVKIKK"
     MKKKNIIIVM GVILVFSMGV YMEKHFSFSR GLVEGTQDVL RKTHILSERL VKEIKQAIST        60
     VKITSAIILG ILAKGNIKNR LVKIKK                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page