(data stored in ACNUC7421 zone)

EMBL: CP001720.PE67

CP001720.PE67        Location/Qualifiers
FT   CDS             73616..74974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0069"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   nar:Saro_3029 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61032"
FT                   /db_xref="GOA:C8VVG7"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024025"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61032.1"
FT                   /translation="MIHKFTIDQINIVLDVNSGALHVVDDLTMLVLEDYLSLSIEDILN
FT                   KHRDIYSEQEITGVCDEINELRKEGLLFSEDPLQNNDYLPGEGVVKALCLHLAHDCNMR
FT                   CRYCFAGQGKFGGSSDLMPLNVGKKAMEFLIKSSGSRRNIEVDFFGGEPLMNFKVLQDL
FT                   VYYGEGLASANGKIIKFTVTTNGLLLNKEVEDFLNCHDISTVLSLDGRPDLHNYMRPMP
FT                   NGEGSYKYVLPNFQRFVNSRHQEDYYIRGTYTHHNLDFSKDIFHLAGLGFNSLSIEPVV
FT                   AESGKDYALQEEDLPVIEREYEILAQGLLEYARKGNNISFFHFNIDLDGGPCLAKRLTG
FT                   CSAGYEYLAVAPNGDIYPCHQFVGRKNFLLGNVFDGISKKEIAIDFRRAHVYNKPECMD
FT                   CWAKFYCSGGCHANAEAFNGTIYKPYDLACKLARKRIECALYYNIKKGLDNSQ"
     MIHKFTIDQI NIVLDVNSGA LHVVDDLTML VLEDYLSLSI EDILNKHRDI YSEQEITGVC        60
     DEINELRKEG LLFSEDPLQN NDYLPGEGVV KALCLHLAHD CNMRCRYCFA GQGKFGGSSD       120
     LMPLNVGKKA MEFLIKSSGS RRNIEVDFFG GEPLMNFKVL QDLVYYGEGL ASANGKIIKF       180
     TVTTNGLLLN KEVEDFLNCH DISTVLSLDG RPDLHNYMRP MPNGEGSYKY VLPNFQRFVN       240
     SRHQEDYYIR GTYTHHNLDF SKDIFHLAGL GFNSLSIEPV VAESGKDYAL QEEDLPVIER       300
     EYEILAQGLL EYARKGNNIS FFHFNIDLDG GPCLAKRLTG CSAGYEYLAV APNGDIYPCH       360
     QFVGRKNFLL GNVFDGISKK EIAIDFRRAH VYNKPECMDC WAKFYCSGGC HANAEAFNGT       420
     IYKPYDLACK LARKRIECAL YYNIKKGLDN SQ                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page