(data stored in ACNUC7421 zone)

EMBL: CP001720.PE69

CP001720.PE69        Location/Qualifiers
FT   CDS             75959..76873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_2630 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61034"
FT                   /db_xref="GOA:C8VVG9"
FT                   /db_xref="InterPro:IPR039568"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61034.1"
FT                   /translation="MANINRKLLRSESHFNLREKVFKLFAVLSVVLIAVFACLPENARG
FT                   YGYSLYREAIKMSTLFNVRNMTALEGPHFVVKYPSDVEVAEARLVLNTAEKFYTPVSED
FT                   YNYSPSKKIPVIVYSSKEKLNGFFGWPASESAMGVYWSGIICVLSPKTWIDSDNPDKIE
FT                   DIFVNSGPMAHEYTHLVVDYITRGNYPRWFTEGLAQYEEYKLTGFRFTETGGNLNQDLY
FT                   SFNDLTQNFDYLPNQSLAYRQSFAAVKYLADNHGQEGIIKIMNLLSQGKSIDAALRSIT
FT                   GTGVDGFEDNLTHWIFNNISQFG"
     MANINRKLLR SESHFNLREK VFKLFAVLSV VLIAVFACLP ENARGYGYSL YREAIKMSTL        60
     FNVRNMTALE GPHFVVKYPS DVEVAEARLV LNTAEKFYTP VSEDYNYSPS KKIPVIVYSS       120
     KEKLNGFFGW PASESAMGVY WSGIICVLSP KTWIDSDNPD KIEDIFVNSG PMAHEYTHLV       180
     VDYITRGNYP RWFTEGLAQY EEYKLTGFRF TETGGNLNQD LYSFNDLTQN FDYLPNQSLA       240
     YRQSFAAVKY LADNHGQEGI IKIMNLLSQG KSIDAALRSI TGTGVDGFED NLTHWIFNNI       300
     SQFG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page