(data stored in ACNUC7421 zone)

EMBL: CP001720.PE72

CP001720.PE72        Location/Qualifiers
FT   CDS             78981..79169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0074"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dvl:Dvul_0113 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61037"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACV61037.1"
FT                   /translation="MFVVTIDQDKCEGCGECAESCPADILGFENGKAFVSGDANDCMGC
FT                   ETCVSVCPAGATSIEEK"
     MFVVTIDQDK CEGCGECAES CPADILGFEN GKAFVSGDAN DCMGCETCVS VCPAGATSIE        60
     EK                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page