(data stored in ACNUC7421 zone)

EMBL: CP001720.PE73

CP001720.PE73        Location/Qualifiers
FT   CDS             79361..80230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0075"
FT                   /product="Nitrate reductase gamma subunit"
FT                   /note="PFAM: Nitrate reductase gamma subunit; KEGG:
FT                   ppd:Ppro_1535 nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61038"
FT                   /db_xref="GOA:C8VVF4"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVF4"
FT                   /inference="protein motif:PFAM:PF02665"
FT                   /protein_id="ACV61038.1"
FT                   /translation="MNFFVGQVMPYITIIVFTVGILYRLSRWGRTRIVHNITLSDNIGP
FT                   THWPKSNAEVLALIGSEAFLFRSLFRFDKGLWAGAWIMHISLLNILGGHVVGFYTLGKQ
FT                   FTYIGMSEAMSEHASELLGTSFGIIIFFALLYLLYRRLAVAAVKQVTVTSDILQLLLLI
FT                   GIVSAGNFMRLFPDYAVHYETANSIVGGIVHLNPVALPDNIFFTIHFFLVQVLLMIFPF
FT                   SKLMHVLGMFVERNIVNRVYKELPPGLPGINVPVENAVDVLYSPSIEARDNCPACVSVS
FT                   GGVKNAGV"
     MNFFVGQVMP YITIIVFTVG ILYRLSRWGR TRIVHNITLS DNIGPTHWPK SNAEVLALIG        60
     SEAFLFRSLF RFDKGLWAGA WIMHISLLNI LGGHVVGFYT LGKQFTYIGM SEAMSEHASE       120
     LLGTSFGIII FFALLYLLYR RLAVAAVKQV TVTSDILQLL LLIGIVSAGN FMRLFPDYAV       180
     HYETANSIVG GIVHLNPVAL PDNIFFTIHF FLVQVLLMIF PFSKLMHVLG MFVERNIVNR       240
     VYKELPPGLP GINVPVENAV DVLYSPSIEA RDNCPACVSV SGGVKNAGV                   289
//

If you have problems or comments...

PBIL Back to PBIL home page