(data stored in ACNUC7421 zone)

EMBL: CP001720.PE77

CP001720.PE77        Location/Qualifiers
FT   CDS             83925..85343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0079"
FT                   /product="sulfite reductase, dissimilatory-type alpha
FT                   subunit"
FT                   /EC_number="1.8.99.3"
FT                   /note="KEGG: dal:Dalk_4301 sulfite reductase,
FT                   dissimilatory-type alpha subunit; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type alpha subunit; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61042"
FT                   /db_xref="GOA:C8W1Y8"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Y8"
FT                   /inference="protein motif:TFAM:TIGR02064"
FT                   /protein_id="ACV61042.1"
FT                   /translation="MSFEPQEPKKVIKYEDVRIYTDAEINNYTEEELKAFKIKYDIPDL
FT                   EELENGPWPSFVADAKQAALHRSKLPADRMLIDPNGVEDMLGQLQVSFDEGETHWKHGG
FT                   IVGVFGYGGGVIGRYSDLPERFPSIAHFHTVRLNQPASKFYNTDFLKSLCDLWDYRGSG
FT                   MLNLHGSTGDIILLGTTTEQLEPIFFEVTHVMDQDIGGSGSNLRTPSCCIGKARCEWAL
FT                   YDTQEMCYEMTNYYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRI
FT                   DQAAVQAYINGEYAPNAGAHAGKDWGKFDIKKEVLDLCPTKCMWMEGGELKIDNAECTR
FT                   CMHCIAVMPRALRPGTDTGVTILCGAKAPILDGAQMSTLIVPFMKAEPPYDNIKEFIEK
FT                   VWELWMEEGRNRERLGEMIQRITLPKFIETIGLPATPQMVKAPRSNPYIFWKEEDVPGG
FT                   WDRDINEYRARHKR"
     MSFEPQEPKK VIKYEDVRIY TDAEINNYTE EELKAFKIKY DIPDLEELEN GPWPSFVADA        60
     KQAALHRSKL PADRMLIDPN GVEDMLGQLQ VSFDEGETHW KHGGIVGVFG YGGGVIGRYS       120
     DLPERFPSIA HFHTVRLNQP ASKFYNTDFL KSLCDLWDYR GSGMLNLHGS TGDIILLGTT       180
     TEQLEPIFFE VTHVMDQDIG GSGSNLRTPS CCIGKARCEW ALYDTQEMCY EMTNYYQDEL       240
     HRPAFPYKFK FKFDGCPNGC VASIARSDMS FIGTWRDDIR IDQAAVQAYI NGEYAPNAGA       300
     HAGKDWGKFD IKKEVLDLCP TKCMWMEGGE LKIDNAECTR CMHCIAVMPR ALRPGTDTGV       360
     TILCGAKAPI LDGAQMSTLI VPFMKAEPPY DNIKEFIEKV WELWMEEGRN RERLGEMIQR       420
     ITLPKFIETI GLPATPQMVK APRSNPYIFW KEEDVPGGWD RDINEYRARH KR               472
//

If you have problems or comments...

PBIL Back to PBIL home page