(data stored in ACNUC7421 zone)

EMBL: CP001720.PE81

CP001720.PE81        Location/Qualifiers
FT   CDS             87560..88153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0083"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="KEGG: dal:Dalk_4306 protein of unknown function
FT                   UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61046"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z2"
FT                   /inference="similar to AA sequence:KEGG:Dalk_4306"
FT                   /protein_id="ACV61046.1"
FT                   /translation="MIIADLFHEYEQLVAKAEHSFQETEKNHSDCIKCDIHCSDCCHAI
FT                   FGVFIIEAAYINYHFKKMDAKIRQEINVMAEKFDLELQSKAQTGEPIEKLRVRCPLLND
FT                   KQECQMYKHRPITCRVYGVPTMIDGKVHVCYKSGFKNNQVYPVFSLDMMYKELFELSVR
FT                   YLEALQYDKDENAALLLSVSTVLQKPIEEILKEI"
     MIIADLFHEY EQLVAKAEHS FQETEKNHSD CIKCDIHCSD CCHAIFGVFI IEAAYINYHF        60
     KKMDAKIRQE INVMAEKFDL ELQSKAQTGE PIEKLRVRCP LLNDKQECQM YKHRPITCRV       120
     YGVPTMIDGK VHVCYKSGFK NNQVYPVFSL DMMYKELFEL SVRYLEALQY DKDENAALLL       180
     SVSTVLQKPI EEILKEI                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page