(data stored in ACNUC7421 zone)

EMBL: CP001720.PE86

CP001720.PE86        Location/Qualifiers
FT   CDS             complement(90540..94163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0088"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: eca:ECA2957
FT                   pyruvate-flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61051"
FT                   /db_xref="GOA:C8W1Z7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W1Z7"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACV61051.1"
FT                   /translation="MAKASKTMDGNEAAAYISYPFTEVAAIYPITPSTPMAESVDLWAA
FT                   HGKKNFFGQTVRVVEFQSEAGASGGMHGSLAAGALTTTYTASQGLLLMIPNMYKMAGEL
FT                   LPAVFHVTARAIATHALSIFGDHQDVMSCRQTGVALLASASVQEAMDLGCIAHLSAIKS
FT                   RIPFLHFFDGFRTSHEVQKIEVLDYTEVSKLLDYEAIKEFRDRSLNPEHPSIRGTAQNP
FT                   DIYFQGREASNPLYDKVPDIVESYMREISRITGRDYKPFDYYGAEDAEYVIVAMGSVCE
FT                   TIDETIDYLRGKGEKVGTIRVRLYRPFSAQHFFNVLPPSVKSIAVLDRSKEPGSVGEPL
FT                   YLDIVKSFYNKDKKPVLVGGRYGLGSKDTRPSQIIAVFNNLKSGTPKDRFTIGIHDDVT
FT                   HTSLPEEDIIETTPQGTINCKFWGLGSDGTVGANKTAIKIIGDNTNLYAQGYFSYDSKK
FT                   SGGTTVSHLRFGKQPIRSTYLVYNADYIACHNSSFIFHYDLLKGLKKNGTFVLNCHWKT
FT                   NELEEKLPSYIKRYLAQNHINFYIINAIDIASEIGLGARINMIMQAAFFKLANVIPLEN
FT                   AVKYLKDSIVSSYGHKGQNIVDMNNKAVDKGISSLVKVEVPAGWANADDENQPVKEEPF
FT                   FTKNFQRPMARMEGDELPVSAFKGREDGTFPLSTTAYEKRGIAARIPQWQPEKCIQCNQ
FT                   CSFICPHAVVRPFLLNEEEVKKAPSSFITKKATGKGLEGLQYRIQITPLDCTGCGNCAD
FT                   VCPAPGKALIMNDPEEEIAAQSDNWEFARLLTGKSHLIDHRTVKGSQFAKPLFEFNGAC
FT                   PGCGETPYIKLLTQLFGDRMMIANATGCSSIYSASAPSFPYTTTAEGKGPAWGNSLFED
FT                   NAEYGYGMLLGVSQIRERLADLMRTALGEKSAGELNSDLTLEAAHGKASDQVLRQISPE
FT                   AAAVPLSAELQEAFREWLAGMYDGEASKSAAAKILAALKDFGNAENQLIKEIIDKKDFL
FT                   IKKSQWIIGGDGWAYDIDFGGLDHVLAAGEDVNMLVLDTEVYSNTGGQSSKSTPTAAVA
FT                   KFAASGKKIKKKDLGMMMMNYGYVYVAQICMGANMNQTVKAMVEAESYKGPSLIIAYSP
FT                   CINHGIRSGMGTSIAEEKKAVEAGYWHMYRYNPMLKEEGKNPFILDSKEPNESYKDFIK
FT                   GEIRYSSLLNAFPEHAEKLMEESAKQARERYEGYKKLAETK"
     MAKASKTMDG NEAAAYISYP FTEVAAIYPI TPSTPMAESV DLWAAHGKKN FFGQTVRVVE        60
     FQSEAGASGG MHGSLAAGAL TTTYTASQGL LLMIPNMYKM AGELLPAVFH VTARAIATHA       120
     LSIFGDHQDV MSCRQTGVAL LASASVQEAM DLGCIAHLSA IKSRIPFLHF FDGFRTSHEV       180
     QKIEVLDYTE VSKLLDYEAI KEFRDRSLNP EHPSIRGTAQ NPDIYFQGRE ASNPLYDKVP       240
     DIVESYMREI SRITGRDYKP FDYYGAEDAE YVIVAMGSVC ETIDETIDYL RGKGEKVGTI       300
     RVRLYRPFSA QHFFNVLPPS VKSIAVLDRS KEPGSVGEPL YLDIVKSFYN KDKKPVLVGG       360
     RYGLGSKDTR PSQIIAVFNN LKSGTPKDRF TIGIHDDVTH TSLPEEDIIE TTPQGTINCK       420
     FWGLGSDGTV GANKTAIKII GDNTNLYAQG YFSYDSKKSG GTTVSHLRFG KQPIRSTYLV       480
     YNADYIACHN SSFIFHYDLL KGLKKNGTFV LNCHWKTNEL EEKLPSYIKR YLAQNHINFY       540
     IINAIDIASE IGLGARINMI MQAAFFKLAN VIPLENAVKY LKDSIVSSYG HKGQNIVDMN       600
     NKAVDKGISS LVKVEVPAGW ANADDENQPV KEEPFFTKNF QRPMARMEGD ELPVSAFKGR       660
     EDGTFPLSTT AYEKRGIAAR IPQWQPEKCI QCNQCSFICP HAVVRPFLLN EEEVKKAPSS       720
     FITKKATGKG LEGLQYRIQI TPLDCTGCGN CADVCPAPGK ALIMNDPEEE IAAQSDNWEF       780
     ARLLTGKSHL IDHRTVKGSQ FAKPLFEFNG ACPGCGETPY IKLLTQLFGD RMMIANATGC       840
     SSIYSASAPS FPYTTTAEGK GPAWGNSLFE DNAEYGYGML LGVSQIRERL ADLMRTALGE       900
     KSAGELNSDL TLEAAHGKAS DQVLRQISPE AAAVPLSAEL QEAFREWLAG MYDGEASKSA       960
     AAKILAALKD FGNAENQLIK EIIDKKDFLI KKSQWIIGGD GWAYDIDFGG LDHVLAAGED      1020
     VNMLVLDTEV YSNTGGQSSK STPTAAVAKF AASGKKIKKK DLGMMMMNYG YVYVAQICMG      1080
     ANMNQTVKAM VEAESYKGPS LIIAYSPCIN HGIRSGMGTS IAEEKKAVEA GYWHMYRYNP      1140
     MLKEEGKNPF ILDSKEPNES YKDFIKGEIR YSSLLNAFPE HAEKLMEESA KQARERYEGY      1200
     KKLAETK                                                                1207
//

If you have problems or comments...

PBIL Back to PBIL home page