(data stored in ACNUC7421 zone)

EMBL: CP001720.PE91

CP001720.PE91        Location/Qualifiers
FT   CDS             101549..101863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dal:Dalk_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61056"
FT                   /db_xref="GOA:C8W2Q0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q0"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACV61056.1"
FT                   /translation="MGGNMNKMMKQVQKMQADMLKMQEELANRTVVSTAGGGAVKVTVN
FT                   GKQEILAIEIKPEAVDPEDVEMLQDLILAAVNEGIKNSQEMVNKEMGKLTGGLNIPGLF
FT                   "
     MGGNMNKMMK QVQKMQADML KMQEELANRT VVSTAGGGAV KVTVNGKQEI LAIEIKPEAV        60
     DPEDVEMLQD LILAAVNEGI KNSQEMVNKE MGKLTGGLNI PGLF                        104
//

If you have problems or comments...

PBIL Back to PBIL home page