(data stored in ACNUC7421 zone)

EMBL: CP001720.PE92

CP001720.PE92        Location/Qualifiers
FT   CDS             101875..102474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0094"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: bsu:BSU00210 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61057"
FT                   /db_xref="GOA:C8W2Q1"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q1"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACV61057.1"
FT                   /translation="MLNHSGVVSRLINEFSLLPGVGPKTAQRIAFYLLNAPEEVAHRLA
FT                   EAVREARDNIKYCSVCSNLTDVDPCLICSDNKRSKNIICIVQEPRDVIAMEKSRGFKGL
FT                   YHVLHGAISPMDGIGPENLRIKELLSRLHKEKVGELILATNPNVEGDATAFYLARLIKP
FT                   LGIKVTRIAHGLPVGACLEYADGVTLTKALEGRQEI"
     MLNHSGVVSR LINEFSLLPG VGPKTAQRIA FYLLNAPEEV AHRLAEAVRE ARDNIKYCSV        60
     CSNLTDVDPC LICSDNKRSK NIICIVQEPR DVIAMEKSRG FKGLYHVLHG AISPMDGIGP       120
     ENLRIKELLS RLHKEKVGEL ILATNPNVEG DATAFYLARL IKPLGIKVTR IAHGLPVGAC       180
     LEYADGVTLT KALEGRQEI                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page