(data stored in ACNUC7421 zone)

EMBL: CP001720.PE94

CP001720.PE94        Location/Qualifiers
FT   CDS             103104..106628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0096"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: dvl:Dvul_0348
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61059"
FT                   /db_xref="GOA:C8W2Q3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q3"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACV61059.1"
FT                   /translation="MAKVTKTMDGNEAAAYMSYAFTEVAAIYPITPSSLMAELVDEWSA
FT                   YGKRNIFGQPLKVVEMQSEGGAAGAVHGSLAAGTLTTTYTCSQGLLLMVPNMYKISGEL
FT                   LPGVFHVTARAIAGHALSIFGDHQDVMACRPTGFAILASSSVQEAMDMAGVAHLSAIKG
FT                   RMPFMHFFDGFRTSHEIQKIEVINYEDMAKLVDYEALKEFKSRGLNPEHPVVRGSAQNP
FT                   DIYFQGKEAANSYYQKVPSIVEGYMQEIGKITGRQYKLFDYYGAADAEYVIVAMGSVCE
FT                   TIEETIDYLLSKGEKVGVVKVRLYRPFSVEHFLAVMPGTVKKIAVMDRTKEHGSVGEPL
FT                   YLDVVNVFYKKENKPLIVGGRYGLGSKDTTPSQIIAVFNNLKQDDPKDRFTVGILDDVT
FT                   YTSLPEEPLVDTSAEGTICCKFWGLGSDGTVGANKSAIKIIGDHTDLYAQGYFAYDSKK
FT                   SGGSTISHLRFGKNPIKSTYLVINSDYTACHNSAYIYKYDVLKGLKKNGTFVLNCQWSQ
FT                   EELEEKLPAKVKRFVAENNINFYIIDAVKIAQEIGLGGHINMIMQSAFFKLANVIPVED
FT                   AVKYLKDSIEKSYGKKGDNIVDMNFAAVDRGIDALVKVNVPADWAGVQDEAEVEQNEPD
FT                   FIKNILRLMVKNEGDSLPVSAFMERVDGSLPVGSSAYEKRGIAVMVPEWQPDNCIQCNQ
FT                   CSFVCPHAAIRPFLLNSEEAAKAPATFITKAAKGKGLEELGLQYRMQVSTLDCTGCGNC
FT                   VETCPAKEKALVLKSADEQNSEQVANWGFAATVSIKDKLLDPKTLKGSQFKQPLFEFSG
FT                   ACPGCGETPYIKLITQLFGDRMMIANATGCSSIYGASSPAIPYTTNSEGKGPSWANSLF
FT                   EDNAEFGFGMYLGVKQTRDKLAGLMKQVVETSDSDVLKEACHEWLAGMNEAEASKAAAS
FT                   KLLAVLEGIDYSGNKAIEEIVEKKDYLVKKSQWILGGDGWAYDIGFGGLDHVLASGENV
FT                   NVLVMDTEVYSNTGGQSSKATPTGAVAKFAASGKKIKKKDMGLMAMSYGYIYVAQIALG
FT                   ANMSQALKAIAEAEAYDGPSLIIAYAPCINHGIKSGMGTSTAEMKKAVAAGYWHLYRYN
FT                   PILKDQGKNPFILDSKEPQDSYKEFLTGEVRYASLQQTFPDIAEKLFEAAEQDSKERLA
FT                   NYKRLAGE"
     MAKVTKTMDG NEAAAYMSYA FTEVAAIYPI TPSSLMAELV DEWSAYGKRN IFGQPLKVVE        60
     MQSEGGAAGA VHGSLAAGTL TTTYTCSQGL LLMVPNMYKI SGELLPGVFH VTARAIAGHA       120
     LSIFGDHQDV MACRPTGFAI LASSSVQEAM DMAGVAHLSA IKGRMPFMHF FDGFRTSHEI       180
     QKIEVINYED MAKLVDYEAL KEFKSRGLNP EHPVVRGSAQ NPDIYFQGKE AANSYYQKVP       240
     SIVEGYMQEI GKITGRQYKL FDYYGAADAE YVIVAMGSVC ETIEETIDYL LSKGEKVGVV       300
     KVRLYRPFSV EHFLAVMPGT VKKIAVMDRT KEHGSVGEPL YLDVVNVFYK KENKPLIVGG       360
     RYGLGSKDTT PSQIIAVFNN LKQDDPKDRF TVGILDDVTY TSLPEEPLVD TSAEGTICCK       420
     FWGLGSDGTV GANKSAIKII GDHTDLYAQG YFAYDSKKSG GSTISHLRFG KNPIKSTYLV       480
     INSDYTACHN SAYIYKYDVL KGLKKNGTFV LNCQWSQEEL EEKLPAKVKR FVAENNINFY       540
     IIDAVKIAQE IGLGGHINMI MQSAFFKLAN VIPVEDAVKY LKDSIEKSYG KKGDNIVDMN       600
     FAAVDRGIDA LVKVNVPADW AGVQDEAEVE QNEPDFIKNI LRLMVKNEGD SLPVSAFMER       660
     VDGSLPVGSS AYEKRGIAVM VPEWQPDNCI QCNQCSFVCP HAAIRPFLLN SEEAAKAPAT       720
     FITKAAKGKG LEELGLQYRM QVSTLDCTGC GNCVETCPAK EKALVLKSAD EQNSEQVANW       780
     GFAATVSIKD KLLDPKTLKG SQFKQPLFEF SGACPGCGET PYIKLITQLF GDRMMIANAT       840
     GCSSIYGASS PAIPYTTNSE GKGPSWANSL FEDNAEFGFG MYLGVKQTRD KLAGLMKQVV       900
     ETSDSDVLKE ACHEWLAGMN EAEASKAAAS KLLAVLEGID YSGNKAIEEI VEKKDYLVKK       960
     SQWILGGDGW AYDIGFGGLD HVLASGENVN VLVMDTEVYS NTGGQSSKAT PTGAVAKFAA      1020
     SGKKIKKKDM GLMAMSYGYI YVAQIALGAN MSQALKAIAE AEAYDGPSLI IAYAPCINHG      1080
     IKSGMGTSTA EMKKAVAAGY WHLYRYNPIL KDQGKNPFIL DSKEPQDSYK EFLTGEVRYA      1140
     SLQQTFPDIA EKLFEAAEQD SKERLANYKR LAGE                                  1174
//

If you have problems or comments...

PBIL Back to PBIL home page