(data stored in ACNUC7421 zone)

EMBL: CP001720.PE99

CP001720.PE99        Location/Qualifiers
FT   CDS             109875..110951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0101"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: geo:Geob_2151 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61064"
FT                   /db_xref="GOA:C8W2Q8"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W2Q8"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ACV61064.1"
FT                   /translation="MLLSASQDIKTLHLLDNCYPKRSFSMHMFSQIIGHKSLIRGLEQA
FT                   VATGRVAHAYLFSGQHGVGKKTTALALSASLLCDFNRSGDACGKCTSCRQLVNGNHPDL
FT                   HIISPDGASIKIEQIRDLQQKARYKSYQNKHQIFIIDQAEGMTREAANCFLKILEEPPE
FT                   QTVFILISAEPELLLPTVISRCQPMSFKDLGLEEISSLLIQLSGVNQEKAGLAAQMARG
FT                   SIGRALSYFNDDQQYKLRELVIRLSQSTRRSAISLLLQEVEELLGKKVNIFEMLEMLSL
FT                   WYRDLLIWKSSHNEKLVFNRDKLDVIDTEAEHYTLEKLVNALEMSEMTKYKLMRNANRR
FT                   AALDVLLLSLTRLGRGEH"
     MLLSASQDIK TLHLLDNCYP KRSFSMHMFS QIIGHKSLIR GLEQAVATGR VAHAYLFSGQ        60
     HGVGKKTTAL ALSASLLCDF NRSGDACGKC TSCRQLVNGN HPDLHIISPD GASIKIEQIR       120
     DLQQKARYKS YQNKHQIFII DQAEGMTREA ANCFLKILEE PPEQTVFILI SAEPELLLPT       180
     VISRCQPMSF KDLGLEEISS LLIQLSGVNQ EKAGLAAQMA RGSIGRALSY FNDDQQYKLR       240
     ELVIRLSQST RRSAISLLLQ EVEELLGKKV NIFEMLEMLS LWYRDLLIWK SSHNEKLVFN       300
     RDKLDVIDTE AEHYTLEKLV NALEMSEMTK YKLMRNANRR AALDVLLLSL TRLGRGEH         358
//

If you have problems or comments...

PBIL Back to PBIL home page