(data stored in ACNUC30630 zone)

EMBL: CP001737.PE107

CP001737.PE107       Location/Qualifiers
FT   CDS             complement(122862..124415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0111"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   scl:sce1510 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76545"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C8X6G3"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV76545.1"
FT                   /translation="MQGRSRDQRELLDAESVVGGLLKPGSVFAFLAAHRREVFPDGMFA
FT                   DLFPSGRGRPSVPADVMASVIVLQALHGLSDADTVDSVTFDLRWKAACGLPVTAAAFHA
FT                   TTLTYWRRRLAASQSPNRIFDAVRQVVDQTGVLAGKSRRALDSTILDDAVATQDTVTQL
FT                   IAAIRRVRREVPGAAEVVGEHCSAHDYDDPGKPAIAWNDQQAREALVDALVTDAHRVLG
FT                   HLPDQELGPKAADAVALLALVAGQDVEPVEGSDGTDGRWRIAQRVAPDRVISTVDPEAR
FT                   HAHKTVHRRQDGFKAHIAVEPDTGLVTACAVTMASGRGNSDAEVGPTLLAQETEKLHVL
FT                   ADSAYGSGSARAELDHAGHIALIKPFPLRSAVPGGFTLDDFTVDPEARTATCPNGVTRS
FT                   ITAQWSVTFGAACRGCPLRAQCTTSDAGRSLKLTEYESLLRAARRQAETEDFQQVYRRH
FT                   RPMVERSISWLVRGNRKVRYRGVAKNDHWWHHRAAAINLRRMLTLGLTRVSGTWTIAPA
FT                   "
     MQGRSRDQRE LLDAESVVGG LLKPGSVFAF LAAHRREVFP DGMFADLFPS GRGRPSVPAD        60
     VMASVIVLQA LHGLSDADTV DSVTFDLRWK AACGLPVTAA AFHATTLTYW RRRLAASQSP       120
     NRIFDAVRQV VDQTGVLAGK SRRALDSTIL DDAVATQDTV TQLIAAIRRV RREVPGAAEV       180
     VGEHCSAHDY DDPGKPAIAW NDQQAREALV DALVTDAHRV LGHLPDQELG PKAADAVALL       240
     ALVAGQDVEP VEGSDGTDGR WRIAQRVAPD RVISTVDPEA RHAHKTVHRR QDGFKAHIAV       300
     EPDTGLVTAC AVTMASGRGN SDAEVGPTLL AQETEKLHVL ADSAYGSGSA RAELDHAGHI       360
     ALIKPFPLRS AVPGGFTLDD FTVDPEARTA TCPNGVTRSI TAQWSVTFGA ACRGCPLRAQ       420
     CTTSDAGRSL KLTEYESLLR AARRQAETED FQQVYRRHRP MVERSISWLV RGNRKVRYRG       480
     VAKNDHWWHH RAAAINLRRM LTLGLTRVSG TWTIAPA                                517
//

If you have problems or comments...

PBIL Back to PBIL home page