(data stored in ACNUC30630 zone)

EMBL: CP001737.PE109

CP001737.PE109       Location/Qualifiers
FT   CDS             125448..126965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0113"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; KEGG: mxa:MXAN_0278 mercuric
FT                   reductase, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76547"
FT                   /db_xref="GOA:C8XIW0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIW0"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACV76547.1"
FT                   /translation="MTSPEPARKAADLAGESDVYDVVVIGGGPPGEIVAQYAIADSTRT
FT                   AVIVEHELLGGECSYWACMPSKALLRPVELLDAARHMPGVASLVAGRTIDVPAVLERRD
FT                   GFTSHHDDKYQVQWANDTGIGVVRGHGRLAGPKQVEVTGADGATRIITARHAVVLATGT
FT                   TASVPDLPGLRAALPWTSRDVTNLHEVPRRVAVVGGGVVACESASWLHGLGVQELTILV
FT                   RGGGLLDRNEPFAGELVAQAFRDAGVKVLLHTGLDEVRRADPAATGEGRTHGGEVTLRF
FT                   GDQTLVVDELVVAAGRTPASADLGLDAVGVDVGASHGFVTTDDQLAVRGVDGQWLYAVG
FT                   DLTGRALLTHMGKYQGRICGAVIAARAEGRPTDGSRFTDLADDGRVPQVTFTDPQVASV
FT                   GRSERQARDAGLDVEAVEYDMAGFAGSSLLRDGYVGRAKLVIDRTTDTLIGATFVGAEV
FT                   AELVHAATVAVVGGVTLEQLWHVVPSYPTMSEIWLKLLEARSAGKAH"
     MTSPEPARKA ADLAGESDVY DVVVIGGGPP GEIVAQYAIA DSTRTAVIVE HELLGGECSY        60
     WACMPSKALL RPVELLDAAR HMPGVASLVA GRTIDVPAVL ERRDGFTSHH DDKYQVQWAN       120
     DTGIGVVRGH GRLAGPKQVE VTGADGATRI ITARHAVVLA TGTTASVPDL PGLRAALPWT       180
     SRDVTNLHEV PRRVAVVGGG VVACESASWL HGLGVQELTI LVRGGGLLDR NEPFAGELVA       240
     QAFRDAGVKV LLHTGLDEVR RADPAATGEG RTHGGEVTLR FGDQTLVVDE LVVAAGRTPA       300
     SADLGLDAVG VDVGASHGFV TTDDQLAVRG VDGQWLYAVG DLTGRALLTH MGKYQGRICG       360
     AVIAARAEGR PTDGSRFTDL ADDGRVPQVT FTDPQVASVG RSERQARDAG LDVEAVEYDM       420
     AGFAGSSLLR DGYVGRAKLV IDRTTDTLIG ATFVGAEVAE LVHAATVAVV GGVTLEQLWH       480
     VVPSYPTMSE IWLKLLEARS AGKAH                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page