(data stored in ACNUC30630 zone)

EMBL: CP001737.PE129

CP001737.PE129       Location/Qualifiers
FT   CDS             148263..148661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76567"
FT                   /db_xref="GOA:C8XIY0"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV76567.1"
FT                   /translation="MTADAFTRAPFGPLKWAALAVAAVGILVVLMWSDQGWLGPTVGYA
FT                   LVIGLVGSVPMGRVIGKHPRTAQLSGGLLIIALAVCVMVSSQSREWGQGVFIALMGILI
FT                   LVQGIFPRLRTWRLGKDPNRTRPPFTAR"
     MTADAFTRAP FGPLKWAALA VAAVGILVVL MWSDQGWLGP TVGYALVIGL VGSVPMGRVI        60
     GKHPRTAQLS GGLLIIALAV CVMVSSQSRE WGQGVFIALM GILILVQGIF PRLRTWRLGK       120
     DPNRTRPPFT AR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page