(data stored in ACNUC30630 zone)

EMBL: CP001737.PE133

CP001737.PE133       Location/Qualifiers
FT   CDS             151150..152610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0138"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: kpe:KPK_0932 cobyric acid
FT                   synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76571"
FT                   /db_xref="GOA:C8XIY4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C8XIY4"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ACV76571.1"
FT                   /translation="MLARDLQARGLLIAGTSSDAGKSLVTAGICRFLARQGLRVAPFKA
FT                   QNMSNNSMVCADGSEIGRAQYLQAQAAGAVPESAMNPVLLKPGSDRRSFVVVRGRPAGT
FT                   LESGEFASGRRHLAQAAFAAYRELAGRYDVIVCEGAGSPTEINLRAGDYVNMGLAQEFS
FT                   LPVVVVGDIDRGGVFASLYGTVALLDAADQALIRGLIINKFRGDVDLLRPGLDRIAQLT
FT                   GVPVLGVLPWLTEVWLDGEDTLQVGRWGAPIGGPEPRLRVAALRFPRLSNVTDLDALAC
FT                   EPGVEVTMTADPGTIRAADLVVLPGSRATVADLTWLHASGLADAVRQAAGRGTPVLGIC
FT                   GGFQMLARTIDDPVESGAGPVSGLGLLPVDVAFAPDKRLGTPAGDWQGHQVRGYEIHHG
FT                   VATVAPGGGDESFLGGVRVGSVWGTMWHGAFENDDFRRAWLRTATEGRFHADAAAPGFG
FT                   ARREAMLDRLADAVAEHLDTDALLALTR"
     MLARDLQARG LLIAGTSSDA GKSLVTAGIC RFLARQGLRV APFKAQNMSN NSMVCADGSE        60
     IGRAQYLQAQ AAGAVPESAM NPVLLKPGSD RRSFVVVRGR PAGTLESGEF ASGRRHLAQA       120
     AFAAYRELAG RYDVIVCEGA GSPTEINLRA GDYVNMGLAQ EFSLPVVVVG DIDRGGVFAS       180
     LYGTVALLDA ADQALIRGLI INKFRGDVDL LRPGLDRIAQ LTGVPVLGVL PWLTEVWLDG       240
     EDTLQVGRWG APIGGPEPRL RVAALRFPRL SNVTDLDALA CEPGVEVTMT ADPGTIRAAD       300
     LVVLPGSRAT VADLTWLHAS GLADAVRQAA GRGTPVLGIC GGFQMLARTI DDPVESGAGP       360
     VSGLGLLPVD VAFAPDKRLG TPAGDWQGHQ VRGYEIHHGV ATVAPGGGDE SFLGGVRVGS       420
     VWGTMWHGAF ENDDFRRAWL RTATEGRFHA DAAAPGFGAR REAMLDRLAD AVAEHLDTDA       480
     LLALTR                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page