(data stored in ACNUC30630 zone)

EMBL: CP001737.PE153

CP001737.PE153       Location/Qualifiers
FT   CDS             complement(172741..173997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0158"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: bxe:Bxe_B1246 precorrin-6Y C5,15-
FT                   methyltransferase (decarboxylating); TIGRFAM: precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating), CbiT subunit;
FT                   precorrin-6y C5,15- methyltransferase (decarboxylating),
FT                   CbiE subunit; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76591"
FT                   /db_xref="GOA:C8XJ04"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ04"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ACV76591.1"
FT                   /translation="MDVAVDVGLDVKDVGVDVVGLGADGWDGLSPHSRAVLTRAAVVIG
FT                   GARQLALLPEQPGQRRLHLPTPLRAGLLDLLDSSDSPAGPVAVLASGDPLLSGIGGTLV
FT                   ELLGAARVRIHPAVSSVSLAAAEMRWPLAGVDVVSLVGRDLATLRRVLSPGRRVLALSA
FT                   DERTPAAVAALLTEAGFGPSRLTVLGDLGSPQQSRIDLIASDFRGPVSRLNILAIDCVA
FT                   VPGTPPRPLVGGLPDDAFDHDGQLTKRDARASALARLAPAPGQLLWDVGAGAGSVAIEW
FT                   SRVDPRCRAVAIERDPARAARIGGNAAALGVPGLVVVTGAAPAALADLPAPDAVFVGGG
FT                   ATVPGLLDSCWAVLGSGGRLVVHGVTLETERLLVDWHARVGGELIRLSVERVEPLGSFR
FT                   GWAPARPIVQWAVTKESTG"
     MDVAVDVGLD VKDVGVDVVG LGADGWDGLS PHSRAVLTRA AVVIGGARQL ALLPEQPGQR        60
     RLHLPTPLRA GLLDLLDSSD SPAGPVAVLA SGDPLLSGIG GTLVELLGAA RVRIHPAVSS       120
     VSLAAAEMRW PLAGVDVVSL VGRDLATLRR VLSPGRRVLA LSADERTPAA VAALLTEAGF       180
     GPSRLTVLGD LGSPQQSRID LIASDFRGPV SRLNILAIDC VAVPGTPPRP LVGGLPDDAF       240
     DHDGQLTKRD ARASALARLA PAPGQLLWDV GAGAGSVAIE WSRVDPRCRA VAIERDPARA       300
     ARIGGNAAAL GVPGLVVVTG AAPAALADLP APDAVFVGGG ATVPGLLDSC WAVLGSGGRL       360
     VVHGVTLETE RLLVDWHARV GGELIRLSVE RVEPLGSFRG WAPARPIVQW AVTKESTG         418
//

If you have problems or comments...

PBIL Back to PBIL home page