(data stored in ACNUC30630 zone)

EMBL: CP001737.PE17

CP001737.PE17        Location/Qualifiers
FT   CDS             complement(19821..21164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0017"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: azc:AZC_1515 amidase; SNP"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76455"
FT                   /db_xref="GOA:C8XHW4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C8XHW4"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACV76455.1"
FT                   /translation="MNDLVGLGAAFRSGELSPTEHVDDVLARLSGDRLNTVITLNADRA
FT                   RAQASRLADEAAQGHWRGPLHGIAVGVKDLIDVQGLPTRCGSHVLDDAPPADADAPVVA
FT                   ALRAAGAIVVAKMHTQEFAHGPTGDAAATGPAHNPHDPTRITGGSSSGSAAAVAAGYLP
FT                   LALGTDTGCSVRTPAALCGVVGLKPTYGRLSTHGVFPLAESLDHVGFLTTDVAAAQLAW
FT                   SVLGGTADAGARIAGLRVGVLVDDYWRAADPAIDPWATAAVEVLAAAGAEPVAVRTPMI
FT                   EELVAAYPVIVGNEAYTTHAGWLAERGQDYQPLIRERLLGFADRPAREYIGAQRTRHRL
FT                   VAALRAALDGAGGGAGGGGVDVLVLPTTRIRATPIGAPTTRIDGTDVPVRPALLALNSP
FT                   FNLTGWPAVSVPAPVDGLPIGVQVVGVRVAERGVLDVAAALERAWRPA"
     MNDLVGLGAA FRSGELSPTE HVDDVLARLS GDRLNTVITL NADRARAQAS RLADEAAQGH        60
     WRGPLHGIAV GVKDLIDVQG LPTRCGSHVL DDAPPADADA PVVAALRAAG AIVVAKMHTQ       120
     EFAHGPTGDA AATGPAHNPH DPTRITGGSS SGSAAAVAAG YLPLALGTDT GCSVRTPAAL       180
     CGVVGLKPTY GRLSTHGVFP LAESLDHVGF LTTDVAAAQL AWSVLGGTAD AGARIAGLRV       240
     GVLVDDYWRA ADPAIDPWAT AAVEVLAAAG AEPVAVRTPM IEELVAAYPV IVGNEAYTTH       300
     AGWLAERGQD YQPLIRERLL GFADRPAREY IGAQRTRHRL VAALRAALDG AGGGAGGGGV       360
     DVLVLPTTRI RATPIGAPTT RIDGTDVPVR PALLALNSPF NLTGWPAVSV PAPVDGLPIG       420
     VQVVGVRVAE RGVLDVAAAL ERAWRPA                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page