(data stored in ACNUC30630 zone)

EMBL: CP001737.PE174

CP001737.PE174       Location/Qualifiers
FT   CDS             complement(200875..201324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0179"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: xop:PXO_02640
FT                   low molecular weight heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76612"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ25"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACV76612.1"
FT                   /translation="MLGFDPFRDMDRLASRLSNLPVPNGRTPAFMPMDLFRAGDHYILT
FT                   ADLPGVDPGSIDIGIDNNTLTIKAERTARSEDSVQWIASERFTGSFLRQLSLGDGIDTD
FT                   GISASYENGVLTVTIPVADKAKPRRVQIRTGGDRTVVEPQAVAAS"
     MLGFDPFRDM DRLASRLSNL PVPNGRTPAF MPMDLFRAGD HYILTADLPG VDPGSIDIGI        60
     DNNTLTIKAE RTARSEDSVQ WIASERFTGS FLRQLSLGDG IDTDGISASY ENGVLTVTIP       120
     VADKAKPRRV QIRTGGDRTV VEPQAVAAS                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page