(data stored in ACNUC30630 zone)

EMBL: CP001737.PE175

CP001737.PE175       Location/Qualifiers
FT   CDS             complement(201564..202778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Namu_0180"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: scl:sce7667 ROK
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Namu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACV76613"
FT                   /db_xref="GOA:C8XJ26"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8XJ26"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACV76613.1"
FT                   /translation="MAPRSPTARGALAIRQSNLREHNLGLVLRIIVDASTPPSRADIAA
FT                   TTGLTRATVSSLADALIEAGLVTELPPVMSQRAGRPAVPLVAAAGTLAAVGMEINVDYL
FT                   SVRVIDLAGRVLHQQVRAANFRHSDPATVIPELVGLFRTATGAVDPGVQIAGAGLAIPG
FT                   LVDRPTGPVRLAPNLGWRDVDVAKVFRAELGAAQLAMVLDNEATLAARAESDALRAHGP
FT                   HTFLYLSGEVGIGGALVLDGSVFGGRHGWSGEIGHTVIDPDGPRCRCGATGCLEQYAGK
FT                   DALMRAAGLDVSLPIEQLQLAAAAGDPAAVAAFAMGSRTLGTAIANAVNLVDVETVVLG
FT                   GLYAGLYDQLVSGIEQVLQERVLAAPWSPMRVRAAVVREAAAVTGAASAVLSQVIDHPS
FT                   GWMHQ"
     MAPRSPTARG ALAIRQSNLR EHNLGLVLRI IVDASTPPSR ADIAATTGLT RATVSSLADA        60
     LIEAGLVTEL PPVMSQRAGR PAVPLVAAAG TLAAVGMEIN VDYLSVRVID LAGRVLHQQV       120
     RAANFRHSDP ATVIPELVGL FRTATGAVDP GVQIAGAGLA IPGLVDRPTG PVRLAPNLGW       180
     RDVDVAKVFR AELGAAQLAM VLDNEATLAA RAESDALRAH GPHTFLYLSG EVGIGGALVL       240
     DGSVFGGRHG WSGEIGHTVI DPDGPRCRCG ATGCLEQYAG KDALMRAAGL DVSLPIEQLQ       300
     LAAAAGDPAA VAAFAMGSRT LGTAIANAVN LVDVETVVLG GLYAGLYDQL VSGIEQVLQE       360
     RVLAAPWSPM RVRAAVVREA AAVTGAASAV LSQVIDHPSG WMHQ                        404
//

If you have problems or comments...

PBIL Back to PBIL home page